Domain SALE 1BTC

Лог чата за 13.12.2016 Цена BTC: $775

День   0.5%      Неделя   2.7%

bitcoin

becool: Хватит дурандить

becool: Наххрена вам 6квт долгое время?

eleon: becool, привет нову джвижняк где?

kslavik: eleon, батарейка на 14квч

becool: часик два пороботали и всё,

sleekka: eleon, сами ждемс

SumyNJC: eleon, у меня среднее потребление 85 квт в сутки. Сколько мне надо батареек? И какой площади крышу стелить? ))))

becool: eleon, фиг знает

becool: е, если елеон имел ввиду ддля майнинга то да

kslavik: SumyNJC, тебе нужно 2-3 батарейки - и 85квч в сутки - это дофишга

becool: Но майнинг это не специфичное потребление электричества

eleon: SumyNJC, проще битки купить на эту сумму и не парить мозг батарейками, а то эта музыка будет вечной

becool: Не обычное то есть а специфичное, или станки

Girt: becool, привет

becool: А так человек от силы пару часов в день юзает электрические приборы пощностью 2 квт и выше

kslavik: с моим майнингом у меня в сутки - 166квч

Girt: becool, пошли спать- всем насрать на твои и мои выводы

becool: Ну какие батарейки когда майнинг, вы одурели?))

eleon: Girt, не правда нова посится)))

kslavik: без майнинга расход в сутки - 30квч

eleon: becool, зеленые , какие еще)))

becool: Нет ну вообще я могу подсказать тему для вас тогда

becool: Реально пацаны тема

SumyNJC: becool, а ты пробовал майнинг с велоприводом?

becool: Как раз вам пойдет

SumyNJC: вот https://www.youtube.com/watch?v=NJyjUL3lQME

eleon: becool, остановись а то мы не заткнем фонтан

becool: SumyNJC, я свиней хотел так

SumyNJC: круто!

becool: но на самом деле не так всё просто, хотя может посмотрю твое видео и легче представлю себе как

becool: https://www.youtube.com/watch?v=Mt5Bi8fdjV8 Вот я же вам давал уже устройство которое 20 квт выдает на дровах

becool: Отапливаешь дом и дополнительно электричество нахаляву

becool: Эот стендовый образец!

becool: Вариант на продажу автоматическая подача дров, отвод тепла,и завод воды внутрь обратно

becool: стоимость 1500 долларов за квт у этого мужика, специально для лесопилок установка, там где дерево нахаляву, тепло идет на сушку пиломатериалов, в сушильные камеры

becool: Забыл только на склько киловатт сколько дров в час расход. Именно электричество 11%-15%, остальное на отопление.

becool: Но хомяк еще круче, будущее за хомяком

becool: В америке фермер короб на беговые дорожки поставил , если не ошибаюсь каждая корова выдает 2 квт 10 часов в день!

alpet: и у кого руки чешутся биток продавать по текущим ценам... натащили 2000 откуда-то

becool: *коров

alpet: becool, 300 хомячков с беговыми колесами решат проблему домашней генерации

becool: Американский фермер рассчитал что если бы всех коров в мире поставили на беговые дорожки то только того бы напряжение хватило обеспечить всех людей напругой

core: alpet, это ж хорошо что натащили, иначе точно нормального пампа не получится

becool: alpet, В реале а не для видео чтобы он целый день бегал ему должна сыпатся еда когда бегает, там не так то просто

alpet: becool, для того и нужно 300, чтобы часть бегала, а часть отдыхала

becool: Не ну может белочки и хомячки и правда сами бегают, я не в курсе. но коровы сами не бегают по беговой дорожке если еда не вылезает спереди

becool: alpet, Ну лично я хомяков не ем, держать их только ради электричества?

becool: Количество вырабатываемого электричества больше зависит от массы существа чем от времени, с хомяка ты много не получишь

ka50hokum: becool, а с них еще и шерсть брать можно

SumyNJC: Эх, если бы коровы торговали на бирже, а не только хомяки... )))

ka50hokum: becool, и статическое электричество от шкуры

becool: Да вы в рукиподнимите хомяка и крову поднимите, почуяли разницу? Вот она и дает электричество

becool: От коробы реальный генератор на 2 квт шпарит!

becool: А от хомяка фуфлыжный на 0.1 ватта наверно только

becool: От коровы столько было бы электричество что даже обогрев бы можн было в доме делать, от одной причем, поставили бы маляный радиатор и хватало бы

becool: А от хомяка вот только один диодик из фанарика, смех. Вы просто наверно не в курсе что с ветряка сколькоберут когда ветра нет как сразу падает мощность? Вот и тут так

becool: К ферме из видях только коровы подойдут, хомяков не хватит

becool: И про три зернышка враки, чтобы он вот так целый день бегал якобы эотт ваш хомяк пол батона скушает за день, и зернышки не прокатят все звери когда от них что-то хочешь булочку давай, как и людям тоже.

SumyNJC: becool, Зато этот хомяк Стёпа "намайнил" своему хозяину около $2000 за два дня! )))

becool: БЛя!! Я хотел сосвиньей сделать!

becool: SumyNJC, теперь опередят!!

becool: причем 1.5 года над уже продумовал

becool: у меня тогда и животных то не было, теперь есть животные но уже не до того, а на видео уже другой заработал((

michwill: Корова - на самом деле, не экологичное животное. Оно производит глобальное потепление! (согласно официальным лицам Калифорнии)

becool: Повар говорит что сам вместо хомяка будет бегать за булочку))

michwill: http://rare.us/story/california-decides-to-regulate-cow-farts-in-order-to-fight-global-warming/

eleon: michwill, +100500

alpet: опять рост предыдущего дня хорошним

becool: michwill, не это не та статья, там 2 квт на беговой дорожки

michwill: becool, да, это другая. Неучтенные экономические факторы коровьего майнинга, так сказать

becool: Коровы просто идут там по беговой дороге. не бегают а медленно ходят.

michwill: А это неважно

michwill: Они все равно метанируют

becool: Вы не поняли, фишка там была в томчто специальные беговые дороги, а ту посто колесо

michwill: С другой стороны, если в любом случае владеешь коровами - это ок

becool: а я так и непонял что значит метанируют? Говнят то есть?

michwill: Пердят

michwill: И власти калифорнии вводят налог на это

becool: а как метан собирать в коровнике?

michwill: Ну типа глобальное потепление вызывают и все дела

michwill: Никак :-) Все владельцы коров платят

michwill: Таковы нравы США, ничего не поделаешь

becool: скоро коровам нетолько на вымя присоски буду ставить но и на жопу

becool: Чтобы попусту не пердели

SumyNJC: becool, погугли коровы - метан - биореактор

alpet: думаю коров через 15 лет не станет. Как отладят технологию поклеточного выращивания и 3D-печати стейков, так и нафиг они нужны

alpet: заодно все воинствующие веганы впадут в уныние

michwill: У коров есть достоинство, что они самореплицирующиеся

SumyNJC: http://img1.joyreactor.cc/pics/post/корова-метан-лига-биологов-газ-3157215.jpeg

michwill: Из подручных ресурсов (трава)

becool: alpet, это от подхода зависит, сейчас тоже агрохолдинги делают химическую еду и ты ее ешь, а вот стерлингов говорит тебе просто нажо электричество в городе отключить и ты автоматически распространишься по руси матушки со своих городов

alpet: michwill, все биоматериалы при наличии питательной среды можно размножать. У коровы много побочных продуктов, тот-же навоз и метан

becool: SumyNJC, Это на серьезе или прикол?

alpet: becool, стерлигов миллионы делает на продаже эко-продуктов. Это талант надо иметь, чтобы так впаривать

becool: alpet, он помимо продажи эко продуктов помогает людям создать эко поселения, и в первую очередь давит на это, так что не надо гнать

SumyNJC: becool, http://joyreactor.cc/post/2665542

becool: alpet, И в итоге миллионы он делает на вашей лени

SumyNJC: это больше на прикол похоже, но есть и промышленные образцы, где метан получают в реакторе после брожения коровьего и свинного говна

alpet: becool, меня не прет от эко-поселений. Пускай энергичные там вкалывают, с утра до ночи )

michwill: Космические поселения лучше, да

becool: SumyNJC, Так тут то и загвоздвка, читал я это, не так то просто

becool: alpet, ну вот и ешь тогда химию

becool: alpet, или плати энергичным

becool: SumyNJC, Вот кстати тоже, слушай, они ээтот газ фильтруют чтбы потом в ДВС и для энергии, посмотри видео промосковские очистные

alpet: becool, химию кушаю, и даже ГМО продукты без проблем. Хотя куда страшнее, это употребление алкоголя

becool: SumyNJC, а чтобы жечь он сразу готов! Ну так епти, не могло мозгов хватить не фильтры а котел и паровую турбину ставить? Еще одни идиоты

becool: SumyNJC, Вотм то и задницачто паровые турбины спецом забыты

becool: SumyNJC, А для готовки сам у себя на даче можешь тупо компостную яму накрыть полиэтиленом сделать трубу, и к газовой плите и гтовить, для подкормки навоз с толчка подбрасывать

becool: Была бы у тебя паровая машина и в электричество бы легко, а так засрется быстро дизель и сгниет от азотной кислоты да и еще там куча чего лишнего.

michwill: Топливные элементы вроде метановые есть?

becool: У меня приятель еще 10 лет назад в солидворке делал диплом минитурбину паровую

michwill: Или можно биотопливо напрямую в электричество даже

becool: Там катализаторы дорогие

becool: Это раз. А то что метан напрямую ну так в том то и фигня что он там ну настолько не чистый.. если готовить будешь у тебя там всё будет вонять не газом оборудование а говном

becool: Но в азии людей не парит в принципе, но правда у них там и не с навоза готовят а якобы со спортившихся фруктов. но думаю и серут тоже заодно

becool: Сама то еда кстати пахнуть не будет, очень очень надо будет принюхиваться чтобы уловить, если конечно плиту протирать тряпкой время от времени

becool: Азиаты то любят работу, они протрут все и трубы изнутри, но главное комфорки надо

becool: В наших условиях северных важнее и проще навоз на отопление пустить

becool: А это проще, нужно слой сделать 40-50 см с опилками перемешать и всё, внутри будет 40 градусов, навоз надо будет подкидывать постоянно

becool: И перемешивать, с чем животные справляются

root: начали с теслы - закончили коровами на беговой дороге )

becool: Чтобы на свиньях реально заработать надо бидонами со столовки жратву возить в машине.

becool: root, Любые типа халявные заработки 1) отдаются хозяину котнторы или начальнику 2) не долги. И только на заводе или в колхозе постоянно требуются но желающих нет.

becool: Но реальность такова что тут хотя и начат сложно зато масштабирование сколько угодно

becool: Мясо жрать все хотят и детали всем нужны

ka50hokum: root, они будут заряжать теслу

becool: А ведь производство может быть и только формально. разливать что-то по бутылям и клеить этикетки. Например в Москве продаются канистры с концентратом сока, а в Питере как и других крупных городах России и тем более в мелких наверно нет.

becool: Зато есть в бочках. Купил бочку, разлил в канистры по 5 или 10 литров, увеличил стоимость раза в 3 минимум, дальше три бочки. И прямо как у американских милионеров с яблоками мытьем, а тут и мыть то не надо, только разливать и наклейки клеить

becool: Бочки по 200 литров

becool: Просто русские стали ленивыми но озлоблеными от пропаганды и не хотят ничего делать

rubiport: Посоветуйте фильм

rubiport: Опа ча ракета вверх

becool: ага

Butiful: "По соображениям совести", если найдешь в нормальном качестве...

becool: rubiport, фильм "Дурак", про таких как бикул в РФ

becool: rubiport, 2014 года

becool: 2000 долларовэто сколько мужик заработал на хомяке так на эти деньги можно былоутеплить дом, не пилить целыми днями дрова и давным давно заснять свинью в колесе, причем это было бы круче и было бы 100 000 просмотров

rubiport: Пасиба за подсказки фильмов

rubiport: Свалил смореть кино думаю бум падать

kaonashi: туземун заказывали?

darkstar_: получите, распишитесь

kaonashi: 5500 взяли)

lunahod: кранты кефиру

lunahod: когда же лайт уже не выдержит и все местные орки

lunahod: форки *))

kaonashi: не выдержит в каком смысле? лайт просто ждет, прицеливается

lunahod: kaonashi, не выдержит и рванёт к 40$

raptorz: В след. жизни

lunahod: верните цены 2014 года на местных форках

raptorz: лайт мертв

lunahod: ерунда всё это )) может быть что угодно

lunahod: лей кефир не жалей

lunahod: биток 800 на хуоби

lunahod: мой прогноз как уже говорил здесь 840 в китае 900 примерно

kaonashi: 1.2 юаня до 3хлетнего хая

darkstar_: лей кефир, ска

lunahod: kaonashi, сейчас флаг на луне поставят и вниз к саге полетят )) может быть и такое

darkstar_: lunahod, нам на марс надо

tandm: lunahod, да все что угодно может быть

tandm: еще бакс задампиои зачем-то )

kaonashi: lunahod, твои 460 которые были в августе уже не такие реальные)

lunahod: kaonashi, ну почему ракета она как и собака всегда возращается ))

kaonashi: тандм прав. никто ничего не знает. и может быть все что угодно)

tandm: kaonashi, но 780 сегодня надеюсь пробъем )

darkstar_: tandm, продали акции роснефти - укрепили рубль)

tandm: darkstar_, да это опек со своим сговором

tandm: 14-го фрс еще дровишек подкинет со своей ставкой. будет интересно кто кого)

darkstar_: tandm, ты не кеноб?)

tandm: darkstar_, нет. а должен? )

darkstar_: да не, так)

kaonashi: проверка на кенобность)

tandm: kaonashi, 2+2? )

kaonashi: ога)

tandm: у кефира график как будто его электрошоком реанимировать пытаются )

lunahod: на 230 надо резко биток , иначе толка не будет ))

lunahod: хомяки сами виноваты не надо было по 770 брать

Butiful: все, допробивались хаев

hazarun: tandm, Похоже, скоро Повар проиграет 10 Дашей ? Осталось менее 5 % до 800 ?

Butiful: hazarun, ты на график смотришь вообще?)

hazarun: Butiful, На графике более 5 % до 800 ?

Butiful: hazarun, ну 800 то 800.Когда, завтра 800 будет?)

Butiful: эй хомячеллы вы чего льете то? Хай же пробили, завтра 800 или 40к, кому там сколько нужно...

lunahod: мне дайте 230 и губозакаточную машинку

lunahod: hazarun, на хуоби 800 было )) даже 801

Butiful: lunahod, сквизов наверное больше не будет у нас уже, никогда(

hazarun: Butiful, Я не сказал что будет. И тем более сроки. Просто, вероятность того, что курс до НГ совершить движение на 5 % достаточно велика.

Butiful: lunahod, на хуоби сейчас черти только начинают разогревать сковородки

lunahod: Butiful, да это не важно что у нас не будет , главное чтобы на поло были

Butiful: hazarun, для меня она ничтожно мала для тебя достаточно велика, сколько людей столько и мнений...

lunahod: на поло манипулятор кона POT что то знает , заранее зарядил +60% перед сливом

lunahod: коина*

lunahod: Butiful, у нас тут вообще складывается впечатление что одни боты остались

Pikachu2017: lunahod, то есть знает? Что знает? И что зарядил, я вижу объём его свеч не больше 60 бтк, манипулятор...

Butiful: lunahod, у меня это впечетление уже давненько тоже складывается)

lunahod: Pikachu2017, в общем уже слив близко , раз в форки начинают битки сувать

lunahod: Pikachu2017, а может слив вот только что начался

Pikachu2017: lunahod, ну да, на тв последние прогрызи от гуру говорят что скоро слив

Pikachu2017: Прогнозы*

lunahod: Pikachu2017, это плохо (( смотри тв и делай наоборот

lunahod: Pikachu2017, верным индикатором тв был бы если говорили берите биток глупцы скоро 4000$ тогда верняк надо продавать

Pikachu2017: lunahod, там есть нормальные, я о tradingview

lunahod: Pikachu2017, в любом случае на 3d видно что скоро обильные дожди начнутся

Butiful: lunahod, такова жизнь что нужно делать наоборот чем говорят в оф. сми

lunahod: висдом что там умер ))

Butiful: говорят нац валюта укрепилась - беги меняй на бакс, говорят что завтра все обвалиться и будет ад - беги сдавай бакс и т.д.

lunahod: а это интересная мысль )) сейчас отключат все телевизоры с графиками и начнут слив

lunahod: Butiful, зомбоящик управляет людьми

Butiful: lunahod,))) просто основная масса должна всегда быть в проигрыше, поэтому так и выходит...

PREDATOR999: Butiful, только сегодня смотрел новости и думал о том, чтобы нужно входить в НГ в баксе:)

PREDATOR999: Butiful, слишком уж сладко поют про обвал джорджиков. Не спроста...:)

Butiful: PREDATOR999, в январе подскочит курс будет 71-73, весной 53 можно ждать, потом опять вверх будет...

hazarun: Butiful, Так понимаю, ты расчитываетшь на скорый слив по ТА ? Вероятность есть, на фоне заседания ФРС.

Butiful: PREDATOR999, бакс еще подпрыгнет но он уже выдыхаеться пока что, в долгосроке бакс в низ с 2017 года. Лучший вариант прыгнуть в евро ниже 1

denn2013: Как красиво. Буры пошли

PREDATOR999: Butiful, план выйти из битка 14 числа и перейти в бакинский, после отскока снова купить крипты.

Butiful: hazarun, я на такие вещи как ФРС на крипте даже не заморачиваюсь...

hazarun: Butiful, Да, про ФРС, не стоит особо морочится. Реального воздействия не оказывает. Но, манипулятор - может использовать это событие в своих целях.

Butiful: hazarun, все на графике рисуется, кто хочет искать новость или причину то их можно под график найти по 5-ть штук на каждый день. Я не из тех кто уделяет внимание внешним каким-то вещам. И да, я пока что расчитываю на коррекцию нормальную, а там уже будет видно что дальше

tandm: hazarun, манипуляторы используют любую новость, даже высосанную из пальца. а 800 - будет )

core: ну все щас китайцы не отвертятся ) щас нормальные биржи уже вытянут курс )

Butiful: но скажу так, мое имхо что нам очень повезет если биточный памп продолжиться дальше и мы не уйдем опять на полгода-год в очередной флэт или еще хуже слив и т.д.. Хотя есть вменяемые обоснованные прогнозы в долгосроке на 9,5к, но я пока не спешу с такими закидонами, я больше реалист чем оптимист

lunahod: бур чтоли сломали (( срочно зовите брюс уилиса из армагеддона он знает как бурить

core: этот "памп" так-то с конца 2015 уже идет ) а мож это и не памп вовсе?

lunahod: корекция ))

core: рияльный спрос )

lunahod: самое интересное начнётся когда опять будет уполовинивание ))

Butiful: core, ну памп не памп, можно назвать как хочешь. В то что рынок сам двигается я не очень верю...

core: Butiful, ну вот так и двигается воздухом ) Медленно закупают, затем резко сливают, но курс при этом растет каким-то магическим образом растет )

Butiful: core, рыяльный спрос говоришь? Ты видеш толпы новых юзеров стремящихся закупить биток по любой цене как это было в 2013 и т.д.? Тут чат так вообще вымирает потихоньку, все тише и тише с каждым днем, не то что раньше было, а ты говоришь спрос

core: ладно хер с ним, пипка главное зашевелилась

lunahod: core, мамонты просыпаются

lunahod: нейм пипка и нова встают из могилы

Butiful: пипка это хорошо, хотя мне нейм нужен, я вчера купил немного его, а не пипку

lunahod: пора уже им блокчейн размять совсем уже к земле примёрзли

lunahod: x10 ннада

core: голосуем кстати за нову, не забываем ) Там еще чуть-чуть и она гейкоин обойдет )

Butiful: core, lol

lunahod: core, у новы нет столько голосующих ))

denn2013: 5550 и 5544.5 совпало или мм с юмором?!:)

lunahod: denn2013, ну тут можно шуткануть ещё лучше 5550 это последние цифры телефона горячей линии Сбербанка

lunahod: или для тех кто думает что в цифрах не бывает случайностей )))) Кала Патар (5550 м) Высочайшая вершина, доступная для восхождения во время треккинга к базовому лагерю Эвереста

denn2013: lunahod, так вот, кто бит пампит

Aleksandrovich: всем куу)

lunahod: denn2013, митч ? )))

lunahod: лезет на Эверест (8848 м)

denn2013: lunahod, скорее Греф)

hazarun: denn2013, Митч, колись.

lunahod: как слив пошёл так графики на висдоме сломали

hazarun: Крупнейший банк Норвегии начал предлагать удобные операции с биткоинами

hazarun: Вроде это первый банк, что начал работать с Биткоином ?

lunahod: hazarun, вроде да

darkstar_: а приватбанк не считаецо?

lunahod: вообще биток пойдёт по графику зотота , и похоже действительно сквизы кончились (( будем медленно двигаться вверх с мелкими корекциями

hazarun: darkstar_, Чё вопросом на вопрос отвечаешь. Просвети, что там с Приватбанком.

lunahod: http://ru.investing.com/commodities/gold-streaming-chart

lunahod: hazarun, https://bitnovosti.com/2015/12/15/privat-bank-to-support-bitcoin/

lunahod: hazarun, новость старая но вроде ничего нового нет

darkstar_: да. приватбанк чота с битком мутил. давно уже

hazarun: lunahod, Почитал про Приват банк. Мутно там всё. Биткоины - они только принимают. Зачисляют гривны на карту. В Норвегии - гораздо прозрачнее, похоже. Так что Приват, не буду засчитывать. ))

darkstar_: okay

hazarun: darkstar_, Да и было это год назад, что скажут очевидцы на сегодня ?

darkstar_: ну новость позитивная. надо брать)

hazarun: darkstar_, Дык, в декабре, что то кучи позитивных новостей для Битка. Впрочем и рост довольно уверенный.

darkstar_: это же хорошо)

darkstar_: еще бы эфир слили

hazarun: darkstar_, Стоишь в короткую по Эфиру ?

lunahod: эфир наоборот ждёт слив битка

darkstar_: http://coub.com/view/ivtjk

darkstar_: hazarun, )) yes

hazarun: darkstar_, В МТ4 позиции открыл ?

darkstar_: hazarun, поло

hazarun: Слышал Кеноби Даши закупает ?

darkstar_: врут)

hazarun: darkstar_, Ну... появится, у самого спрошу. Вроде он так говорил. Только с другого ника.

darkstar_: 3pio?

hazarun: ага

darkstar_: мм

hazarun: это же его ник ?

darkstar_: да

darkstar_: старфиш и ботхулио)

hazarun: Звёздную рыбу - знаю. А вот Ботхулио - не знал.

hazarun: Хакеры утверждают, что украли и ликвидировали 110 000 REP (эквивалент $300 000) в цифровой валюте Augur плюс дополнительно неизвестную сумму эфира (криптовалюты на блокчейне Эфириума), у Бо Шена, основателя венчурной фирмы Fenbushi Capital.

lunahod: hazarun, агурцы лили 6 декабря на поло , кстати как и эфир

darkstar_: hazarun, эту новость вчера отыгрывали?

hazarun: darkstar_, Не знаю. Не слежу за Авгуром.

hazarun: Крупняк, подбирается к Биткоину. --- Банк Японии и Европейский Центральный Банк (ЕЦБ) объединились для работы над научно-исследовательским проектом с целью изучения потенциально возможных вариантов применения технологии Blockchain...

lunahod: нову надо по 1000$ пусть тоже банки обратят внимание ))

hazarun: lunahod, Пацаны, работают над этим. ))

lunahod: по хорошему стакан как и у даши пустой на покупку )) а цена у даши 9$ да и самой даши в 4.5 раз больше чем новы

lunahod: нову надо на поло они там мигом бы её в 100 раз пропампили

lunahod: весь кефир бы в нову слили ))

hazarun: Ага, Бекул - был бы рад. ))

lunahod: hazarun, сразу бы за паровым агрегатом побежал

lunahod: hazarun, да что там , поезд паравой сразу бы купил

pumpdump: Все ждут какда биток вниз а форки вверх - никакда )

Aleksandrovich: почти

lunahod: pumpdump, никогда не говори никогда

hazarun: lunahod, Может, Бекул бы одумался. Не стал паровоз покупать. Просто, провёл бы себе газ. ))

pumpdump: lunahod, пока ждут этого точно не случится )

lunahod: hazarun, не это слишком просто , да и супостатам платить надо

hazarun: точна

hazarun: lunahod, Ща, Бекул придёт, спросим. ))

Aleksandrovich: кефир такой тормоз

hazarun: Венесуэлла, последовала примеру Индусов. )) --- Стоимость биткоина превысила $790 на китайских биржах и $780 платформе Bitfinex, отреагировав, согласно некоторым предположениям, на новость о решении правительства Венесуэлы вывести из обращения купюры с самым высоким номиналом.э

hazarun: Bitstamp, одна из первых криптовалютных бирж, предприняла уникальный шаг, объявив о привлечении $ 1,2 млн в обмен на 2% акций...

hazarun: Сплошной позитив для Битка идёт в новостях. Даже странно, за такой медленный рост.

Aleksandrovich: а китай в низ вроде рулит

darkstar_: кефир отвлекает

lunahod: hazarun, самое главное что новости выходят как раз когда вроде слив намечается )) типа давайте хомяки берите на пике

Selin: hazarun, как это первая? cryptorush points, феникс вот вообще никого не спрашивал и привлек 100k btc пользовательского баланса в обмен на свои акции "tokenЭ

hazarun: Selin, Не я писал эту новость. Кстати, её уже удалили. ))

Selin: hazarun, и правда, куда то делась:)

hazarun: Selin, Низя тут про индусов и биржу. Это секретная информация. ))

darkstar_: Selin, привет, лиса)

hazarun: Ладно, будем обсуждать паровые машины и наиболее эффективные удобрения. Про них - можно.

lunahod: hazarun, правильно )) а то все индусы уйдут отсюда на свою биржу

hazarun: ))

Selin: darkstar_, привет!

darkstar_: бикул тоже уйдет?

hazarun: darkstar_, Не... Бекул - будет тут обсуждать наиболее эффективные удобрения.

Selin: бикул никуда не уйдет, это наше наказание за грех спекуляций :)

lunahod: ктож кроме бикула вам глаза на справедливость ещё откроет

darkstar_: Selin, это пять)))

lunahod: точнее на не справедливость *

lunahod: товарищ манипулятор на битке хочу передать вам привет и заказать биток по 460 желательно к январю , спасибо ))

Strej: Привет народ ! на чем сегодня едим?

Aleksandrovich: а лучше по230))

darkstar_: lunahod, лучше ботов изучай)

darkstar_: Strej, колбасу пока на хлебе

alpet: теперь биток сбрасывают выверенными сливами, стоит подойти к 775

Allexx: Strej, я на столе, не знаю, кто как

Strej: везде тихо ! биток ползет к 800

darkstar_: как ник читаецо?

Strej: к новому году допалзет )

darkstar_: к какому именно? 31-го, по старому или по восточному)

Strej: darkstar_, и какого года )

darkstar_: Strej, как твой ник читаецо?

core: а хуоби завис на сливе что ли? это из-за него слив?

lunahod: core, вроде да , как только пошёл слив график на висдоме повис с хуоби

lunahod: не хотят сейчас слива ((

lunahod: а может ботов под слив перенастраивают

Butiful: lunahod, ни кто и спрашивать не будет хотят или не хотят:)

lunahod: Butiful, Партия сказала: надо, Председатель ответил: Есть!

Butiful: lunahod, вот-вот

Butiful: следующяя неделька будет пиршество медведей

lunahod: мишка аплодирует за это стоя https://www.youtube.com/watch?v=aBLqftEVnK0

lunahod: Butiful, видел до чего медведей довели )) там на видео даже зубов нет

lunahod: точнее почти нет

Butiful: lunahod, да я посмотрел и ужаснулся если честно(

lunahod: мишки очень хотят кушать https://www.youtube.com/watch?v=RgAX4-KukLk

hazarun: lunahod, Ну старая животина, обеззубела. В природе они не доживают до такого. Раньше погибают.

lunahod: а может медведи пошли стеснительные и поэтому слива нет https://www.youtube.com/watch?v=3ZjWc7jwATo

lunahod: hazarun, я сейчас всеми лапами за медведей

alpet: рубль затормозился после укрепления. А казалось так много его продавали, чтобы удержать уровень 62.5

hazarun: alpet, Завтра-послезавтра заседание ФРС. Никто ща дёргаться особо не будет.

alpet: hazarun, пока что курс рубля все равно отстает от повышения цен на нефть. Помнится такой-же был примерно и при $50 за бочку, а нынче $56

hazarun: Ждут решения ФРС ?

alpet: скорее это общее неверие в закрепление роста, скептицизм такой. Реакция на поднятие ставки на 90% уже заложена в цену, повлиять немного может разве что риторика о планах на следующий год

becool: В МТ4 хоть дважды успеваешь заработать и на падении и на продаже

alpet: на Камчатке вот-вот должен noname вулкан бахнуть, интересно его кто-нибудь снимает на всякий случай?

becool: Вот оно уже удвоение с каждой колебухи

becool: Вот и успеешь в безубыток выйти на маленьких колебаниях

pumpdump: Лайт скора введут на гокс, а емабиль бкдут комплектовать етафоном, 146%

Strej: Strej, Стрежов сокращено стреж

becool: pumpdump, опять ботанические бредни в чате?

pumpdump: becool, ты больше не модер узбагойся )

alpet: вроде как Алеппо захвачен совместными усилиями. Значит в следующем году замороженные пенсии потратят на восстановление инфраструктуры города

alpet: впрочем вероятно также, что денег не хватит и население начнут загонять в ОФЗ. Помощь братскому народу Сирии это слишком важно ))

alpet: так что я не беспокоюсь за судьбу рубля, я в нем просто не сберегаю.

nix: alpet, а тратишь в рублях?

nix: alpet, например, машину за рубли же купил ;)

alpet: nix, конечно в рублях.

nix: а зп получаешь в рублях?

alpet: nix, какая зп?

nix: не работаешь?

alpet: nix, давно уже.

becool: А тут кто-то работает?

becool: Удивительные люди

nix: я работал пару лет назад. как зп стала не 3000$, а 1500 за те же услилия, так бросил

alpet: работать должен электорат, пресловутые 86%. А рантье по статусу не обязательно

nix: ну "работать" понятие относительное. Организовать работу электората - тоже работа

nix: повар пишет в ПМ что скоро зп он мне будет эфиром платить :)

rubiport: Ты работа нас не бойся мы тебя не тронем

alpet: есть очень серьёзное правило в нашей действительности: кто не работает, тот ест. А кто работает, тому есть некогда

alpet: заниматься надо интересным делом, а не РАБотой. Тогда и будет жизнь налаживаться у всех

nix: занятие которым ты занимаешься должно приносить и достойное вознаграждение

becool: nix, а мне он в новах платит

nix: а если нравится врачу лечить людей, а тебе за это платят 100 баксов в месяц!

nix: у меня тёща врач и оклад 6000 рублей

alpet: nix, достойное, в некоторых случаях звучит как проклятие. Думаешь депутаты или Сечин смогли-бы на достойную их успехов зарплату выжить, в 10000 рублей? )

becool: nix, у них там наверно не один оклад а плюс надбавки премии и т.д.?

nix: becool, ну надбавки за стаж 30 лет + премии всякие. выходит 12 тыс

pumpdump: nix, давно бы тещу научил криптой торговать )

nagash513: Слила бы теща все подчистую

alpet: nix, по разнарядке ходит голосовать за ЕР небось, как и все бюджетники?

nix: alpet, да, что самое печальное

pumpdump: nagash513, зато инвестиция в крипту )

becool: nix, ну вот не люблю когда говорят оклад только, устроишься к ним жедопустим водилой. будешь 20 получать, устроишься по айти будешь 15, а они ходят и говорят что 12 а у самих со всеми там туды сюды выходит 18-25!

becool: nix, Просто я работал в таком поганом месте айтишниуом и получал еще меньше их

nix: becool, кто только пришёл туда работать без стажа получает голый оклад

nix: и премии регулярно лишают

nix: средняя зп не больше 10 тыс

becool: nix, ну где я работал там были еще подраотки разные которые не входили в оклад, и из-за недостатка персонала получали все выше меня

nix: ну а ты мог тоже подрабатывть, картриджи продавать налево

nix: или битки майнить на процессорах

rubiport: becool, дорвеи клепать

nagash513: nix, поэтому лучше не работать и сидеть дома

Aleksandrovich: becool, рыба гниет сголовы

becool: nix, и озверевшие бухгалтерши тебя бы с говном съели

rubiport: В аренду офис сдавать ночью

nix: я на видяхах юзеров майнил битки :)

becool: nix, хрень в том что я и так заправлял от работы, сам, за это не получая ничего дополнительно, надо было и правда на лево картриджи, но выходило что мне новых и так мало давали

nix: жаловались что тормозит, я денег на новые компы просил :)

rubiport: Мне нравться как настроеная наша маршрутка , опять забег на реворд.

becool: nix, Вот тымолодец))

rubiport: becool, а че не майнил на процах ?

becool: nix, Только тут насчет некоторых раскрыли люди говорили и уголовное дело завели))

nix: becool, сам так работу поставил. Я покупал только "оригинал". Плюсом 2-3 зп имел сверху

becool: rubiport, Да *ля это давно было! Кстати тогда начальник шепнул рядом парню что вот мол там один кучуденегзаработал на процах, я слышал но не думал что настолько кучу, вот бымнетогда уже интересоватьсябитком начать, это был еще 2011 ил

becool: nix, Н так епти ты там сам заведуешь, ну ты блин сказанул, а когда над тобой начальник айти отдела, а над ним грлавный инженербывший начальник айти, да и директор филиала тоже бывший айти и зам его да бля, там умных с картриджами и остальное пруд пруди

becool: nix, я уже года4-5 не работаю, а ты говоришь словно недавно

nix: Закрыли тему про картриджи :) Разговор про то, что дорогой доллар плохо для простых людей

nix: на путешествие раньше я мог потратить 5000 долларов

nix: а теперь 2500 жалко уже :)

rubiport: Темы дня на сколько мы полетим *?

becool: nix, С фига ли?

becool: nix, смотря какие доходы

nix: доходы у 99% в рублях

alpet: дашу несколько заколбасило, ни туда и ни сюда не

becool: nix, значит ты фигово на бирже зарабатываешь, самстарайся лучше. знакомых родствеников зови, вот тебе сказали тещу звать

becool: nix, Блин. пока ты будешь на 99% смотреть будешь бедным, не тупи, я тоже такой

alpet: на бирже зарабатывают только 5%. Собственно я в основном проигрываю через активную торговлю. Поэтому сайз ничтожный

Strej: alpet, какие прогнозы на дашу

becool: nix, 99% вовсе не такие милые как кажутся, вот я не воровал картриджи и на процах наработене майнил, я чсетный, а ты под видом честного и картриджи воровал и электричество

nix: я тоже торгуя на бирже не зарабатываю

becool: nix, Так что это самые хитрецы, которые и денег не вложить и как бы полегче чего отжать у кого

nix: лучше бы не торговал. а то продал по 20 баксов за биток, пришлось покупать по 200

becool: nix, ну так тебе дай возможность ты просто будешь директоров лупить и деньги забирать

alpet: Strej, я настроился на 3-ье место по капитализации, через несколько лет. Но это оптимизм инвестора, не более )

becool: nix, Вот так и говори что ты лох в торговли

becool: nix, атут мне рассказали про 5летнего пацана короля в торговли

nix: becool, Хитрецы у нас продают наши ресурсы нам же по бешенным ценам

nix: у нас в городе отжали ТЭЦ, теперь электричество в 2 раза дороже стало

Strej: alpet, норм разложил )

nix: и отопление было 850 руб за ГКкал. а теперь 1500

becool: nix, когда биток недавно ыл ниже 300 выклячал у старших сестер братьевденег, говорил на биткоин, ну всем насрать было, долго клянчил, а потом опа и картинку им показывает говорит утроил уже денежки теперь я богат. мало вы мне дали иначе бы я с вами поделился

becool: nix, А когда я тут писал о своей ТЭЦ на меня только нападки устраивали!!!

becool: nix, Просто не тот чат. им что биогаз, чо коровы с педалями что ТЭЦ им только для ботанических разговоров, они делать не хотят

Aleksandrovich: becool, унас еще + водоканал так продали

nix: унас пока водоканал не продали, но говорят что скоро обанкротят, типа тарифы низкие

Aleksandrovich: у нас ваще нихрена ничего своего нет, все продали. а теперь ноют налогов нет, и на приставов давят

becool: Я не понимаю ваше нытье

nix: вот как вороватьнадо!

Aleksandrovich: nix, обанкротят, возьмут перед этим ссуду в банке на него а потом типа убыточное банкротят и продают за копейки с откатом

becool: Нутак купите участок и делайте там свою тэц и свою скважину?

darkstar_: becool, взаимно)

becool: У вас ботаническое нытье чои?

nix: becool, вот это воровство, а не электричество и картриджи. И не кого не посадят

becool: Вчера же уже всё осудили какделать

Aleksandrovich: а воруют они у всех,дети бабушки ты я мы

nix: becool, у меня свой участок, с домом, скважиной и газовой "ТЭЦ"

becool: Нет. это отсуствие конкуренции и крупные чуваки забирают а лохи не могут свои минитэц делать

becool: nix, газовая тоже тема, но не так выгодно

becool: nix, у тебя какой там бвиг?

nix: но газ вырос в цена в 5 раз за 10 лет

nix: 5 руб сейчас за куб стоит

becool: nix, ого, я еще не давно помню 3 был

becool: Так делай паровую машину. она более универсальнаяна любомтопливе работать будет

nix: becool, обычный поршневой

becool: Не ну можно и готовую купить

nix: как резерв использую

becool: nix, не обычный а три варианта 1) выкуниул и взял другойот восьмерки старой 2) сделал капиталку 3) немецкий что дорого возится проще новый агрегат купить

becool: nix, вот в том то и дело что у тебя только ради резервапотому что капиталка дорогая

hazarun: Strej, На Дашу, интересные прогнозы. Кеноби, решил вроде закупиться Дашей. Так , Бекул ?

becool: А паровая машина работала бы в постоянке, а цена капиталки если расчитать на цену киловатта то только 15 центов или ниже

becool: hazarun, он уже закупается

becool: nix, в томто и хернячто стаду дибилов сказали что мол паровая машина кпд маленькийи ля ля, нутак это было когда бензн и нефть дешевые были, и электричество, сейчас другая задача уже

becool: КПД 11-15% но ведь остальное то в тепло идёт, иломаться там практически считатай почти нечему в отличииот ДВС

i_iv: цена движка из японии в среднем 30т.р сломался...выкинул поставил такойже, чё ты помешался на это капиталке

i_iv: только он ещё до капиталки хз скок проработает

i_iv: больше денег потратигь на свою самопал - паровую машину

hazarun: becool, Мы тут задавались вопросом про тебя. Если Нова будет по 1 000 баксов, ты себе принципиально паровоз купишь ? Или газ проведёшь ?

becool: Ты рядом с японией живешь?

i_iv: с доставкой сейчас проблем нет

becool: hazarun, А тысчитаешь смешно?

i_iv: нет не рядом

becool: i_iv, так ты скажи какая машина и какого двиг

hazarun: becool, А низяя ?

becool: hazarun, НЕльзя потму что дибилизм.

darkstar_: becool, toyota 3s-fe

becool: hazarun, Нахрена мне всех соседей спонсировать подводкой газа и электричества

darkstar_: 2.0 литра. жрет 92-й

becool: hazarun, даже если нова и впрямь так вырастет и я до эотго не продам ты считаешьчто это легкие деньги учитывая сколько они меня обсирали?

hazarun: becool, Значит, мы верно угадали ход твоих мыслей.

becool: hazarun, если бы я был ментом генералом вором каким-то то не вопрос,так бы и сделал

becool: darkstar_, Епти так бензин денег стоит!

becool: darkstar_, сколько он проработаетна постоянке?

i_iv: becool, к примеру http://baza.drom.ru/novosibirsk/sell_spare_parts/dvigatel-toyota-1vz-fe-2.0-v-6-47698426.html

darkstar_: http://i.imgur.com/oQytNQM.png

darkstar_: becool, ресурса у него хватит

darkstar_: i_iv, vz то зачем?)) 3s проще однако и расходников как грязи

i_iv: darkstar_, я ему для примера

darkstar_: i_iv, да там глухо) хоть в глаз нассы)

becool: Это у вас расходников может как грязи, а вПитере?

becool: darkstar_, Себе и ссы в глаз

darkstar_: )))

i_iv: на дроме загугли...

hazarun: ))

becool: Это двигатель асам генератор то какой?

core: хватит сраться, лучше голосуйте за нову ))

hazarun: core, Пол дня уже никто не срался. Время пришло.

becool: Эот двиг от автовроде? С ним генератор минимум 200 тыс будет стоить наверно

becool: Плюс в Питере нетак много тайот как увас, 8ок куда больше, тогда можно купить генератор с двигом от восьмерки

darkstar_: да, питер тмутаракань

becool: Но этовсё стоит даже не 200 а 300+ тысяч

becool: Ну так чего вы замолчали то? Где генератор то с двигомчто вы указываете?

darkstar_: идикороче

i_iv: млин ну возьми от "не тойоты" чё как маленький цена доставки тыщи 3..хз плюс минус ...

becool: Да генератор то где??

becool: Что значит возьми

becool: ты на дивгот авто как будешь присобачивать сам чтоли?

i_iv: генератор ты отдельно покупиешь...под свои нужды

becool: i_iv, ну так в этом и разница, тогда бы так и сказал что всеравно самоделишь, только уже целое авто научасток загоняешь для самоделки, а потом покупаешь генератор еще

hazarun: becool, Поглядел ща, был удивлён ценами на генераторы с движком. От 10 000 рублей.

becool: hazarun, с каким движком?

becool: hazarun, самые дешевые бензиновые маленькие есть за 4 тыс руб способны работать и от газа с балона

hazarun: becool, 5 киловатт, - 25 000. За глаза хватит.

becool: То есть самыедешевые еще дешеле, а это с газом

becool: hazarun, Да епти, мачало начинай с начала? Такие ресурс мал

becool: hazarun, Они как резервные и потом вышел из строя выбросил и купил новый

becool: hazarun, Ну чот 100 раз одно и тоже повторять?

becool: Отниматете время только

darkstar_: ритег спасет отца русской демократии

hazarun: becool, Это я всё понимаю. Генераторный движок, должен быть дизельный. Эти подороже будут.

darkstar_: полысеет правда. но не жалко

becool: hazarun, с чего ты взял что дизельный намного лучше?

becool: hazarun, так говорят потому что дизельные бычно крупные и дорогие, онии впрямь лучше что хотя бы ремонтопригодны хоть как-то кним запчасти есть хотя бы, но всеравно не дёшего

becool: hazarun, Онис большим ресурсом, но всеравно не такимчтобы годами работал а потом чуть потратил иснова годами

i_iv: ну ты даешь...а гену для паровой типа сам будешь делать))

becool: i_iv, Паровую ты сам сдлаешь как тебе надо там легко подобраться, а куда ты в авто где повесишь навалу?

becool: На коленвал повесишь?

i_iv: ничё не понял

becool: Просто у авто меньше места, и к тому же как раз есть прибамбаса такая вешается на колеенвал, но для грузовых

core: там ременная передача по умолчанию

becool: Ну так то да

i_iv: всё на шкиву...либо через переходник...

becool: Я так то понимаю что вы правы

i_iv: выточить

becool: Просто перспектива загонять авто и его убивать генератором, потом на метал и новое авто как-то смущает

core: короче куда вам там двигатель от авто? он же мощный. зачем вообще че-то изобретать, когда продается готовое. Вряд ли дешевле получтися собрать.

becool: Просто поршни можно принести на спине врюкзаке или на легковой привезти

i_iv: core, да просто хз что ему та нежно...

i_iv: он и сам не знает

becool: А туубитые авто или возняс двигом привези поставь, двиги авто тяжелые

hazarun: becool, Движки для автомобиля и электростанции - рассчитаны на разные режимы. И движок авто не на это заточен.

core: ну паровая машина круто, че бы не собрать

core: если значешь как.. )

i_iv: я предложил вариант который точно хватит под все нужды))

becool: core, Они так то правы, на авто легче, но столько всяких забот сразу требует

becool: hazarun, ты со своимирозовыми очками уже втирал мне что муравйники экономичнееты думаешь ведь такой был рассчет в советсткое время, вот всоветское они и были экономичны, а сейчас не сонированы то есть не утеплены и много тепла уходит

becool: hazarun, А за тепло и воду и т.д. все комунальные ты переплачиваешь в разы

becool: hazarun, Так и тут, одно дело авто за 20 тысяч можно с нормальным двигом еще с него вседетали снимешь продашь

becool: hazarun, А двиги таки расчитаны, есть готовые устройства, но такой геныч с двигом от восьмерки стоит 300 тысяч рублей

becool: Там плюс с работой от сжиженого газа а не бензина

becool: Нона самом деле постоянно работающийтакой двигун слишкоммного топлива сожжешь

becool: А вот паровая машина работала бы просто пока отапливаешься всеравно дровами, в том то епти и разница

hazarun: becool, Не заколдобишься в паровую машину дрова подкидывать ?

becool: С вамивсегдабоьшеразговоров на ботаническую диванную болтологию, лучше идти и хоть что-то сделать чем болтатьтолько

becool: Всё, ушел работать, итак полтора часа впустую

hazarun: Это - правильно

becool: hazarun, А сейчаспо твоему я чем занят весь день? Всеравно подбрасываешь,такеще пилить приходится, а потом приходишь сюда и вы тут своим ботанизмом диванным еще мозгши конопатите

becool: hazarun, Как ты сейчас было вот мол курс вырастет купишь паровоз или что

becool: hazarun, Хуевоз куплю нормальный, авто.

becool: hazarun, Задолбал уже ваш диванный ботанизм

i_iv: ))

hazarun: тупые, фикли. Один ты умный.

i_iv: бикул убей повара

hazarun: думаешь ?

hazarun: i_iv, Он занят. Некогда ему.

darkstar_: извечная ненависть пролетариата к интеллигенции)

darkstar_: hazarun, под ботанизмом он имел ввиду управление ботами?)

hazarun: ))

hazarun: вот не успел спросить...

darkstar_: лежу на диване, ботами погоняю

darkstar_: диванный ботанизм)

EAZ: бикулизм

hazarun: darkstar_, Ты ботов сам писал или купил ?

darkstar_: hazarun, купил, пытаюсь пейсать.

hazarun: darkstar_, На чём пишешь ?

darkstar_: жаба

darkstar_: правда все времени нет

hades: пейсать - от слова ПЕЙСЫ? Кошерный бот будет ?

darkstar_: )))

hazarun: darkstar_, Тоже вот хочу своих на Джаву переписать. Пока, на Шарп.

darkstar_: чем шарп не устраивает?

darkstar_: надоело памятью управлять?

hades: раньше прикольный контре был - количество людей на сайте и ботов RIP

darkstar_: контре?

hades: каунтер

darkstar_: напиши в саппорт фич реквест)

hazarun: darkstar_, Хочу от ОС Виндовс отвязаться. Под Линух, вроде нет студии для Шарп. С память - это всё решаемо, надо просто копнуть.

darkstar_: йасна

hades: hazarun, а чем тебе mono не устраивает ?

darkstar_: на js надо) чтобы модно моложно было)

darkstar_: *молодежно

hades: ага, на nodeJS

hades: :))

darkstar_: скорости хватит)

hazarun: hades, Это эмулятор Винды под Линухи ?

darkstar_: неее

darkstar_: тычо

hades: mono - mono framework (можно запустать .NET на macOS и Linux)

hades: а для запуска любых приложений на linux/macOS - wine

darkstar_: монаЗапускатьNetнаLinux :D

hazarun: hades, Про запустить, я в курсе. Я про разработку говорил. Есть студия Шарп под Линух ?

hades: хз, разве что запустить в режиме эмуляции под wine

hades: [jnz

hades: хотя

hazarun: hades, Ну и зачем мне собирать все эти шишки. Что я, Бекул что ли... Мне - лениво.

hades: MonoDevelop, the IDE associated with Mono Project should be enough for C# development on Linux. Now I don't know any good profilers and other tools for C# development on Linux.

hades: Вот тебе решение

hazarun: hades, Спасибо за инфу. Буду учитывать.

credent: клятый москаль любыть Паскаль, мы же уси прораммуем на Си ))

jusyk15: credent, прикольно :)

hazarun: darkstar_, Ты разработку в среде какой ОС делаешь ? Что за студия разработки ? НетБианс ?

hazarun: darkstar_, Так то у Жавы и Шарп, много общего. Очень похожая идеология. Про синтаксис, даже и говорить не стоит.

becool: МТ4 дает сразу и терминал и студию для ботов и индикаторы и что угодно

becool: А вы ботоводы до сих пор за столько то лет не сделали ботачтобы деньги считалист сами как в мт4, чем вы там занимаетесь?

becool: Так что ботоводы вы тоже диванные

hazarun: becool, Не, я - на стуле сижу.

3piO: becool, с чего ты взял что не сделали? )))

hazarun: 3piO, Верно говорят, что ты Деш закупаешь нынче ?

becool: 3piO, сого что сколько не спрашивал никто не сказал где скачать аналог МТ4 в плане учета средств терминал, но через АПИ

Aleksandrovich: 3piO, о слухи пошли)))

becool: 3piO, Дажепрограммистам биржи такое не сделать в вэбе((

3piO: hazarun, пару дней назад я грозился войти в дашу в течении месяца. Но я еще не начал, это они спецом курс поднимают, чтоб мне дороже входить ))

becool: 3piO, ч ты врешь то, ты же говорил что уе входил вроде как? Если нет чего ты тогда сразу и не сказал что это не ты поднимаешь

hazarun: 3piO, Чего то ты, увидел в Деш какую то перспективу ?

Aleksandrovich: хомячье вошло)

3piO: becool, я входил на пару дней, но это было нескоко недель назад.

3piO: hazarun, да просто скучно уже, остальные валюты освоил уже

becool: Вот мне хочется клиента который бы считал открытые позиции

Aleksandrovich: becool, он трезвый, видишь не разговорчивый

3piO: Aleksandrovich, )))

3piO: ладно, нет времени болтать, дела...

hazarun: becool, Ага. Помню. Было такое от 3пиО.

becool: Так же как это делает МТ4, но можно как МТ5

becool: Как это делает биржа здесь меня не устраивает

hazarun: becool, Ну напиши так, как тебе хочется. Либо напиши ТЗ и пусть программисты программят.

becool: ТО есть по человечески , вот купил 10 битков. у тебя строка вот ты купил 10 битков цена такая, прибыль на данный момент в баксах столько

becool: А иначе нахрена ж мне терминалы как вот сейчас есть с которыми потом сам сидишь считаешь с калькулем? Так тогда в браузере норма тоже

becool: hazarun, На самом деле это не только мненадо, хочешь сказать никому не надо считать прибыль?

tandm: becool, некоторые боятся ее считать )

becool: tandm, ты кстатиправ, они спецом таких терминалов неделают, что боятся

hazarun: мы - ленивые, как настоящие программисты. Это ты Бекул, как пчёлка.

becool: Можно было бы и не полный аналог как в МТ4

tandm: becool, потому что когда сосчитаешь, 90% успешных трейдеров, которые могут жить и работать в любой точке земного шара, превратятся в обычных лузеров )

becool: Можно оставить счета в валютах

becool: и всё как есть, но только добавить учет открытых позиций на основе сделок

allatermit78: наконец то красной краски завезли

becool: То есть вот мойсчет на бирже, для упрощения считаем что только одна пара и двевалюты которые я прямо так и закидывал и битки и баксы

credent: некому будет торговать, все будут сидеть и прибыль считать

becool: Ибыло 10 биток и 7600 баксов, на момент запуска терминала с учетом позиций

tandm: becool, вопрос - по какой цене переводить битки в баксы?

becool: Дальше я биток продал один, так вот в терминале значит открывается позиция продажи битка. и считается по ней на данный момент прибыль или нет

hazarun: becool, Практика показывает, наиболее затратная в программировании часть работы, это не само программирование, а попытки понять , чего хочет клиент. Потому что он сам обычно, понимает не очень. Что ему нужно и откуда это возьмется.

becool: tandm, Переводить по цене в случае полного соответствия МТ4, а я сейчас про только учет позиций

Halosqf: у всех . письма не идут?)

becool: Так вот в терминале пишет сделка запущена продажа, цена открытия такая, выкупа не было, не закрыта

becool: Тут два варианта или куча открытых отдельно учитываются, эот как в мт4, или одна поза которая модифируется как в мт5

tandm: becool, цена buy или sell? и не факт, что когда ты сольешь свои 10 битков, цена не изменится. Так что можешь точно подсчитать только бумажную прибыль. Настоящую - только когда закроешь все сделки

becool: tandm, Тымне ботанизма врубил? Цена блин по которой ты реально продал, открой журнал сделок и от туда скопируй, какие нафиг туда сюда?

hazarun: tandm, Это как раз случай, описанный мною выше. Я, даже время не трачу на попытки понять. ))

becool: tandm, финансы, история сделок

tandm: becool, тебе не стать моим заказчиком ) не сработаемся

becool: Да я понимаю что мне самому надо писать

becool: Для тех ктопонял по апи беруться все сделки изисториисделок, и группируются в пачку как бы того что ты изначально делал, то есть если ты в этот момент продавал 1 биток, иегопродал, то выводится средняя по истории сделок и по этой цене открыта позиция, то есть на самомделе, уже плюс что такой термина

tandm: hazarun, заказчики иногда такие странные бывают )

hazarun: becool, Ты хотя бы ТЗ напиши. Так, что бы не только тебе было понятно, но и другим.

becool: Хотя бы реальную цену пишет точную по ктоторой продал, потому что тут в вебе никто точно и не знает когда по рынку сливал многопо чем рельно вышло

tandm: becool, тебе за 5 лет историю сделок ворошить?

credent: becool, man mysql

becool: tandm, с чистого листа, делается акк для бота, и туда кодом пересылается битки ибаксы

becool: credent, писать туда php?

tandm: исходные данные: период расчета, учет комсы (в одну/две стороны), и самое главное - по какой цене считать вторую (еще незавершенную) часть сделки

becool: tandm, Ну ты блин даешь

hazarun: ))

becool: tandm, Полуавтомат же получается, я же сказал сам выбираешь он группирует

becool: tandm, После того он уже в прошлое не лезит ана кой хрен?

tandm: becool, админу объясни, в финансах до сих пор неправильно в баксах считается )

becool: Комса естестно в двестороны, а как ты иначе тут сделаешь чтобы не было?

tandm: becool, понятие частично исполненные сделки знакомо?

becool: Код продашь кому-то вне биржи чтобы даже за продажу комсу неплатить?

becool: Незавершенную считать по рынку, с уровнем погружения или нет другой вопрос

becool: Частично истолненые снимать, не учитывать

tandm: becool, да, если депо считать как повар в диванах или упаковках пепси, то надо учесть комсу на вывод. она почти всегда разная

becool: А тебе понятие партионныйучет в торговле похоже? Вот тоже самое

credent: becool, зачем тебе прошлые сделки, живи настоящим... вчера битки были по 3 но маленькие, а сегодня по 5 но огромные такие ))

becool: *знакомо?

3piO: becool, если будет время, я могу информер дополнить твоими пожеланиями...

Selin: tandm, на поло реализован вариант: анализируется по выбранной паре, за выбранный период средняя цена покупки, средняя цена продажи, сколько потрачено битков, на покупку/продажу, и итоговый профит/убыток, удобно (если на одной бирже торговать, полная фигня если торговать еще на 10...)

becool: credent, рассчет позиций, об этом была речь, потом растянули чтобы по 100 раз всё переспросить

tandm: 3piO, вот скажи ему кеноб, что не все так просто даже текущий баланс посчитать )

3piO: tandm, он не поверит )) но я могу под него сделать

becool: tandm, Кт тебе сказал про текущий баланс?

tandm: Selin, там реализован один возможных из вариантов, какой - догадайся сам

becool: Опять ботанический диванизм пошел. человеку одно он тебе другое втирает и ищет всякие подкопы докопы

tandm: becool, незакрытую сделку ты не можешь подсчитать точно

becool: tandm, она не может сам, ей нужен мальчик

3piO: becool, так что пиши в лс ТЗ, потом обсудим что могу быстро сделать, а что не хочу делать

Butiful: becool, на кой тебе нужно это все?

becool: tandm, кто тебе сказал что абсолютно точно?

Selin: Butiful, прибыль считать :) в калькулятор не вмещается :)

becool: Butiful, Нутак чтобы по апи торговать какв МТ4

tandm: Butiful, -x20 на нове чтоб душк грели и оптимизмом заряжали )

credent: becool, если сказать проще, тебе нужен график только твоих сделок, если графически и цифровой можно тоже и плюс бегущая строка - купить/продать прибыль/убыток

Butiful: Selin, та было бы что там считать, а остальное не важно)

becool: Селин нормальную тему сказала и обикеноби

becool: Остальные так и не поняли

Butiful: becool, видимо я чего-то тогда недопонял чего ты хочешь, ну и ладно..

3piO: becool, торги я счас делать не хочу (может потом), но информер, который показывает курсы и спрэды у меня уже есть, туда просто добавить индикаторы, баланс, прибыль...

becool: Ну да, сидите с калькуляторами и всех заставляйте

tandm: becool, Селин тебе открытым текстом сказала - шел бы ты на поло )

Selin: becool, бикул, у нас графики, графики починить уже почти год будет не могут.. а вы новый функционал хотите, а под себя можно сделать что угодно и как угодно..

becool: tandm, ичто?

Selin: tandm, не, не, поклеп, я этого не имела в виду :)

tandm: becool, там уже все сделано

becool: Selin, ага, я понял

becool: Всё, мне идти нао, но я вас понял, дешевле биржу сменить

becool: И валюту тоже, с новы уйти

3piO: вот опять его хлебом не корми, дай поныть. Я же предложил сделать, так это он игнорит )))

becool: На этой и с новой только нищаешь

becool: 3piO, А ты бесплатно предложил?

3piO: becool, конечно

becool: 3piO, Твой монитор бесплатно скачать можно?

darkstar_: 3piO, закупаешься дашей*

3piO: becool, я его радавал, не помню уже где скачать... я счас должен бежать, может вечером обновлю и дам тебе скачать. И еще - я даю исходники - можешь сам проверить нет ли там вредного кода

hazarun: darkstar_, Уже нет, говорит ))

tandm: hazarun, латвийские партизаны бывают иногда очень коварны )

becool: 3piO, Ага, спасибо, пока, тоже бежать надо

3piO: darkstar_, это они курс поднимают чтоб мне дороже входить

becool: tandm, В Питере есть улица Латышских стрелков

darkstar_: hazarun, ясн

darkstar_: 3piO, :)

hazarun: tandm, Точна точна. Латвийские партизаны - коварны. Вчера, одно говорит, сегодня другое. ))

tandm: becool, да ради тебя сделают улицу Аргентинских стрелков тоже )

becool: После Октябрьской революции, во время Гражданской войны в России латышские полки поддержали большевиков и стали одними из первых воинских частей, стоявших у основания РККА.

becool: А до того в первой мировой

becool: Являлись самым крупным национальным военным формированием на службе в Красной армии. Использовались как исключительно боеспособная сила на стороне большевиков. Общая численность около 80 тысяч человек.

hazarun: darkstar_, darkstar_, Ты разработку в среде какой ОС делаешь ? Что за студия разработки ? НетБианс ?

darkstar_: hazarun, винда у меня. в idea.

darkstar_: netbeans ацтой)

becool: Не хрена се сколько латышские стрелки наворотили

hazarun: понял

becool: И антибольшевиские востания подавили

becool: И должностизаняли что первым директором ГУЛАГа был латышский стрелок

becool: Чего ж они теперь так советы не любят когда сами же их и создали?

hazarun: becool, Крови лили щедро, латышские стрелки. И китайские - тоже. Так говорят.

becool: Пойтипоработать толи укрепить стены, а то вдруг рядом латышские стрелки

hazarun: darkstar_, Идеа - платная студия ?

tandm: becool, странная логика. так обобщая можно заявить, что питер ненавидит весь мир

darkstar_: hazarun, есть бесплатная редакция

tandm: hazarun,платная, но недорогая. и триалка есть

darkstar_: tandm, кодишь?

tandm: darkstar_, да

darkstar_: tandm, стек websphere, spring?

becool: Мда, Про Рихарда Зорге лучше читать не буду даже, тот наверно простовзрывал нахер домами что только в честь его одноготоже назвали

becool: Если тут такие дивизии были чтобыв их честь, там наверносовсемотморозок, типа Кадырова

becool: Кстати а где улицу Кадырова сделали? В Москве или Питере?

tandm: darkstar_, пхп+js

becool: Кстати есть фото Высоцкого где он гяляет с собакой, можно узнать обычные 9этажки которые и сейчас стоят, местоузнать

hazarun: becool, Мост Кадырова в Питере. Собирались.

darkstar_: tandm, ок. пойду дальше гуглить)

becool: hazarun, не фига, слышал улицусделали

hazarun: becool, Господь с ними.

darkstar_: hazarun, аллах

becool: hazarun, https://ru.wikipedia.org/wiki/Улица_Кадырова

darkstar_: ну или другая имплементация

hazarun: короче, мне по барабану ))

becool: hazarun, В Москве, в Бутово

becool: hazarun, конечно ты же Ура-Патриот, ленивый

tandm: becool, Биккулово — название населённых пунктов в России. Башкортостан. Биккулово — деревня, Ташбулатовский сельсовет Абзелиловского района.

becool: hazarun, тебе всё нравится что делают власти. пассивно нравится, нравится быть пассивом))

hazarun: becool, Это наезд ? Или комплимент ?

darkstar_: hazarun, его мессаги > /dev/null

becool: hazarun, Ну тебе не хочется знать о улице Кадырова, чтобы ты мог дальше поддерживать Путина пассивно

hazarun: Так мне насрать. Это плохо ?

becool: hazarun, Так то тебе неочень нравится что чеченским боевиком именем улицу в Москве назвали, но лучше просто не думать про эт и тогда Путин хороший

tandm: hazarun, если в лифте - плохо

becool: hazarun, Кстати да, вот такие исрут в лифте

hazarun: tandm, Не... в лифте - не сру. Даже не писаю.

becool: hazarun, это временно

tandm: hazarun, я всегда знал, что ты культурный человек )

becool: hazarun, тебя просто еще твое правильетсльтво не прижало посильнее

becool: Онтебя прижимает а ты делаешь вид что не заметил и хаваешь

becool: Ну у тебя получше дела что работает есть деньги есть

becool: А бываеттак пацаны что потомраз ипи**ец, вот тогда и будешь срать в лифте

tandm: becool, выключай уже режим бога у себя. смирись с тем, что есть вещи на свете, которые происходят без твоего непосредственного участия

darkstar_: ему режим бога на 666d надо)

hazarun: becool, Это хорошо ? Или плохо ?

becool: hazarun, https://www.youtube.com/watch?v=wE3svJxtND0

sooo: becoon, с диагнозами ты все-таки перегибаешь палку

sooo: при всем уважении

hazarun: Вишь, какой ты уважаемый человек !

becool: hazarun, Чел так и не понял что случилось! Он же напозитиве он верил в Пуина смотрел телик, футбол, бабки, работа, верил в Путина, ну как все

darkstar_: sooo, это посетителям чата в наказание)

becool: hazarun, Что парень делал не так что на видео? Жил как все, за что его Путин наказал?

hazarun: becool, Не бегаю по ссылам.

becool: hazarun, это ютуб

hazarun: я в курсе

becool: hazarun, По названию найди в ютубе "Enjoykin — Не унывайте, пацаны "

darkstar_: пролетарий) больше сказать нечего)

becool: darkstar_, Так пролетарий это норма. Жизнь пролетария должнабыть более менее нормальной

hazarun: becool, Зачем мне искать этот негатив ?

darkstar_: becool, да. для тебя более чем норма)

becool: darkstar_, а ты весьтакой не пролетарий. да?

becool: hazarun, Кто сказал что негатив? Для тебя правда негатив?

darkstar_: becool, таки да

becool: hazarun, А ты такой весь на позитиве, да?

becool: hazarun, Это твой сраный лифтовый позитив, он не реальный

tandm: becool, #заоптимизмответишь

becool: hazarun, сегодня он есть нагнаный спецом которого не было. а завтра что-то случилось и пошел срать в ифтах

hazarun: ужась

becool: hazarun, позитив должен быть реальным и не за чужой счет

hazarun: точно говоришь

becool: hazarun, А завтра ты будешь издеваться над людьмичтобы за их счет, напожары ходить смотреть что у тебя лучше, да?

tandm: есть три типа специалистов: кухонные политики, диванные аналитики и лифтовые оптимисты

becool: hazarun, Я понимаю что ты не такой, просто я описываю тех кто с тобой в одной бригаде, какие они обычно поганые люди

hazarun: я - не хожу смотреть пожары. Вышел из того возраста. Это плохо ?

becool: hazarun, Причем тут возраст? Наоборот взрослые собираются в Питере, ты меня удивил что у вас дети

becool: hazarun, Всё,работать надо, хватит трепаться, так весь день протреплешься

hazarun: becool, Я не знаю, кто у нас собирается смотреть пожары.

hazarun: пожарные ?

hazarun: пожаросрач - закончен. Так и не выяснили, кто срёт у Бекула в лифте.

tandm: hazarun, нету у него лифта (. а вот повар в личке передает всем пламенный привет )

darkstar_: hazarun, лучше к нам)

sooo: какое отношение пожары, лифты и кучи говна имеют отношение к битку? делом займитесь и пропампите форк какой-нить

sooo: нову ту же, а то уже без слез не взглянешь - она такая крутая и уникальная, что нахрен никому не нужна)

hazarun: sooo, Не не. Нову - это вы уж сами.

tandm: hazarun, как кто-то начнет пампить нову, все остальные тут же сольют по рынку )

sooo: да мне лично нова нахрен не сдалась)

sooo: power12345 - хватит срать в моем лифте!!! (ПМ)

sooo: мне твой эфир только разве что даром сгодится

sooo: если готов поделиться - щас скину тебе свой адрес для пополнения

hazarun: tandm, Так Альпет, верно говорит. Что даже слить её не получится. Сколько у него. Обрушишь рынок в ноль.

core: hazarun, ни один коин нельзя слить в таком объеме, даже биткоин.. точнее тем более биткоин

core: разве что за несколько месяцев

core: и хорошо что если курс по итогам удержится выше 100

hazarun: Ну да... у тебя, поболе будет, чем у Альпета.

core: с чего ты решил? я нигде не говорил сколько у меня еще ее есть

hazarun: ладно, помолчу

becool: sooo, С чего ты взял что я диагнозы ставлю, скопировал слова у толстого анимешника не могущего определится с полом своим?

hazarun: becool, Кто же срёт у тебя в лифте ? Так и не выяснили.

becool: sooo, троли есть троли, диванные или алкашеские, и у кого недостаток с яйцами наинаетдолгоопределятся девочка онили всетаки мальчик, а ты всех слушаешь

becool: sooo, Самодостаточный человек знает кто он по полу. не сретв лифте и обо всем может говорить не стесняясь и не комплексуя, не делая вид что эотго всего несуществуета он просто маленький винтик

becool: sooo, а недоличности с пароком о тебе будут думать изначально всякие гадости, апотом это выливается. Реально их душит только то что у тебя свободы больше чем у них, ты можешь ничего не делать, их будут душить просто свободные рассуждения, они тоько с этого озвереют, что тут в чате и происходит кажды

hazarun: becool, Правильно, расскажи им сермяжную правду жизни...

becool: sooo, в рассуждении таких людей я просто говорю глупости, поток там чего-то и т.д. Потому что они узки и замкнуты, они винтики, и не только я, заметь такая же ненависть у них к сотику и повару, а у многих и к обикеноби

becool: sooo, видишь вместо серьезного восприятия, для чего нужно сознание, человек отшучивается. не включая сознание имозг, оновыглядет тупо, но такие же его поддержат потому что так ведь смешнее как бы, то есть класс рассмеется над глупой штукой над учителем,тупые поддержат тупого

becool: Я не считаю себя умным или там богом или чсв как онитам называют. они просто сами так себяведут, им так нравится. Ну не хотят люди думать и жить в реальности, имнравится свой маленький мирокписаниясофта

becool: Повар куда интересней человек

becool: Иногад чтобы быть человеком достаточно просто перестать быть винтиком системы и крутить свою систему

becool: Вы такие меня раздражаете, потому что вы родствеников не способны позвать на биржу, новичков мало

credent: becool, почему тогда у тебя все во всем виноваты? чем ты не тот же винтик? только разговорами? твоя система жить на отшибе без нормальных человеческих условий, если не врешь.. спасибо, не желал бы ни кому

becool: credent, Почему на отшибе, я в городе живу

becool: credent, Но ты знаешь лучше бы купил подвал бомбоубежище в свое время. где-то в городе

becool: credent, Были варианты, было бы еще круче

credent: becool, и жить как премудрый пискарь, не высовываться?

becool: credent, Чувак, просто ты выбираешь одно я другое, мне площади нужны для широты шдуши, для простора. а тебе закуток но чтобы всё красиво, у нас разные желания

becool: credent, Нет, и сделать там фабрику мебели например

credent: becool, я не говорил еще о своих желаниях, ты за меня не сочиняй

becool: credent, Не пойдет с мебелью метал обрабатывать, например кованые заборы, ворота

becool: credent, Ты уже сказалмне мол не подходит

credent: becool, сарай за городом - нет

becool: credent, Подвал метров 200 чтоли продавали за 3 млн

becool: credent, Кто тебе сказал что я за городом? Я в городе

credent: becool, а дом нормальный у моря/озера/реки - да, почему бы и нет

becool: credent, На окраине города да, ну так потому чот в центре питера землю не купить

becool: credent, Потому что там нет бизнеса, там только отдых

credent: credent, не обязательно самому жить в городе, чтобы бизнес крутить, можно жить и за городом, но дело не в этом

becool: credent, В центре питера втом же бомбоубежище или просто подвале ты можешь сделать например даже скульптурную матсерскую, и у тебя тамбудут творческие люди тусовать, лепить бюсты и позировать бюстами

becool: credent, Так денег то нетиз-за отсутствия курса новы и вложености в нее, а не из-за сарая, не находишь?

becool: credent, Ииз-за того что ты мне сейчас звездишь об этом не давая работать, нахрен мешаешь?

credent: becool, да, понимаю, каждый попадал на чем-то и в чем-то, но если искать виноватых, кроме себя, то так и будешь попадать

becool: credent, Ктотебе сказал что я ищу виновных кроме себя?

becool: credent, Ты сейчас за свою нападку и виновен

becool: credent, потом нападка другово другой виновен

becool: credent, всемв принципе или нсрать или нападка

credent: becool, это уже обратка тебе идет, а не нападки

becool: credent, Нет нападки, зачастую вообще с человекомдаже не говорил и вдруг он тебе вываливает, мол у тебясообщения длинные нафоруме))

becool: Или девочка который не девочка сходу обиделся из-за ника

becool: На меня и других, ивот теперь никак не успокоится

becool: За что я перед ним виноват был, что он девочка не девочка?

credent: так то мелочи, можно не обращать внимания, зачем после них философию разводить?

becool: Такие люди обижены сами по себе, ты только тронул говно ионо завоняло само

hazarun: Гады и подонки кругом.

becool: Продолжайте без меня вобщем, мненадо поработать

credent: мне просто надоело слушать, как во всем кто-то другой виноват, особенно путин... вон путин украину засыпает своим снегом

credent: легче искать во всем крайних, чем что-то изменить самому

hazarun: ещё, в лифте срут...

credent: хотя бы свое отношение

credent: на счет лифта к стати, этож надо еще успеть там насрать )))) этажет так 16 как минимум

credent: *этажей

hazarun: ну... тут не в курсах

credent: откуда вообще проблема нарисовалась, почему из-за веры или не веры в путина надо обязательно в лифте срать?

hazarun: Что бы не быть винтиком !

credent: )))) точно

credent: так после этого и чат читать не хочется

hazarun: credent, А ты - не читай. Ты - пиши.

credent: сорри, лучше помолчу ))

ibko: какая-то дрянь из Гонконга пыталась пароль сбросить

hazarun: ИП Гонконговский ?

ibko: да

ibko: 103.10.197.194

hazarun: ibko, Дрянь то , скорее из РФ. Прокси и делов то...

hazarun: ibko, Зашли в аккаунт ?

credent: защиту по ip включи, у прова купи выделенный

ibko: я и не выходил из акка, включил 2-ф авторизацию

ibko: почта целая нетронутая

credent: лог входов смотри на почте

ibko: там всё в порядке, проверил.

credent: ну тогда пусть курит кеды китайские...

credent: два мяча

LTC012: поставил двухэтапную аутентификацию, но вот скажите если телефон сломается или потеряется. как потом востановить досутп. iOS

credent: в телефоне и почта тоже и чехол с карманчиками под пластиковые карты?

credent: может скрин qr кода поможет, после переустановки iOS, по-любому через саппорт разрулить можно будет

credent: а вот терять такой телефон не желательно

LTC012: карманчика под пластиковые карты нет )))

LTC012: конечно не желательно. но хочется все предусмотреть. чтобы в дальнейшем обезопасить себя...

credent: просто отдельный телефон нужен, для всех денежных систем, который без джейлов и ломанного софта

credent: и который никуда не носится, а надежно хранится

lunahod: credent, нормальные люди штрих код распечатывают (который ты сканировал 2 фа ) а ещё лучше отдельный телефон

credent: lunahod, скрин сохранить, потом можно и печатать

easybit_pro: ,fhvfukjncx

tandm: credent, небезопасно скрин хранить там же где и вход

lunahod: credent, именно , потом берешь любой телефон сканишь распечатку и вуаля опять всё работает

LTC012: lunahod, это получается лучше код убрать. и вновь поставить, при это сохранив (распечать или сделать скрин монитора с кодом)

ibko: Вроде ж при включении пишут сделать бэкап ключей и кюара

lunahod: LTC012, я скрин делал а потом распечатывал

LTC012: lunahod, спасибо!

lunahod: LTC012, можно если в винде программой ножницы поработать ))

tandm: краткая инструкция по безопасности: отдельная почта, 2фа на отдельном девайсе, белый список ip. И самое главное - никакого интернета!

credent: обмазать член зеленкой, замотать бинтом, облить йодом, надеть пару презервативов и вообще не трахаться

lunahod: tandm, лучше чтоб и на почте 2 фа тоже чтоб было ))

tandm: lunahod, ага и еще менять пароли каждый день, чтоб под холд попасть и вывод хакеру заморозить )

lunahod: ещё и отдельный ноут под биржу или неттоп

credent: и охрану вокруг него

tandm: lunahod, если акк на гоксе, не поможет )

lunahod: tandm, да да круглосуточную ))

tandm: а потом думаешь - нафига все это делал, если форки падают )

lunahod: tandm, да вырастут в течении следующего года ))

lunahod: tandm, если конечно их отсюда не удалят

lunahod: tandm, а если удалят то на поло обязательно вырастут

lunahod: туземун в общем не избежен

lunahod: тут главное откуда и куда и до скольких ))

tandm: lunahod, ждемс... туземуна

lunahod: tandm, только вот пока биток растёт никаких туземунов на форках ((

tandm: lunahod, лайт как-то уныло выглядит. раньше его старались выше 0,005 держать

tandm: а может веру лайтофилов проверяют )

credent: это разворот такой затяжной, потом снова скачки пойдут

lunahod: tandm, лайт вообще не понять (( полетит ли он вверх при сливе битка или с ним полетит не понятно

credent: уже никто никуда не летит )) все идут по своим траекториям, как биоритмы

tapki: снес двухфакторку хочу проверить ключ ввожу он пишет не праавльнгый

tandm: lunahod, а с чего ты взял, что слив битка будет. Помурыжат еще курс недельку и пойдут потом свое рождество празновать. и унылый флет до весны

tapki: сам ключ не qr код

tapki: он че не фурычит пацы

tandm: tapki, так ты ж его снес. Новый-то создал?

tapki: да создал

tapki: на другой трубе ввожу и пишет горох

tandm: tapki, я ручками вводил когда менял, все работало

tapki: просто активирует и показывает мыло но что это бтс аутентифик не показывает

tandm: tapki, синхронизировался?

tapki: вот пример fsfgsdgwsfgvksvmvmsmdfmsmfsmfsf

tapki: очень много букв и цифр не 16 значный он почему то

tapki: он активируеться но не пишет что это код бтс-е

tandm: tapki, это только в qr-коде прописано. а так обзывай как хочешь

lunahod: tapki, допустим никакой ключ не вводил а просто сканировал телефоном свою распечатку с qr кодом

lunahod: tandm, слив будет полюбому , другое дело до скольких

tandm: lunahod, согласен на лайт по 8 и биток 460. или лайт по 3 и биток 1200. )

korki: tandm, а можно серединку - лайт по 6 и биток по тыще? :)

lunahod: tandm, сначало будет примерно 460 а потом уже как раз полетим на 1200

tandm: korki, тоже неплохо )

lunahod: на поло форки уже стали немного подпампливать , значит чуют слив битка

alpet: нефигово так биток валится, к рублю

lunahod: лайт при полёте битка вниз если направится за ним 2-2.5 будет

tandm: alpet, это бакс к курсу 1:1 стремится)

lunahod: а может станут биток переливать в лайт и тогда надо ловить лайт на 20-24 примерно

tandm: lunahod, что будешь делать? ты ж в форках

credent: 950 - 750 - 850 - 600 за 3 месяца примерно, я так вижу

lunahod: tandm, ждать ! ))

tandm: lunahod, отличная стратегия )

lunahod: tandm, форки с поло полюбому вверх полетят

alpet: tandm, бакс-то на месте стоит, рубль пытается расти

lunahod: tandm, я уже смирился с тем что обычно надо ждать 3-4 месяца ))

tandm: alpet, кто-то пропампил нефть, теперь переливается в рубли )

alpet: tandm, уши заказчиков надо искать в США. Это все очень и очень на руку сланцевикам, которые задыхались от кредитной удавки, а сегодня уже фантазируют о миллиардных прибылях и захвате половины рынка у ОПЕК ))

tandm: alpet, не нафантазируешь - не проинвестируют )

alpet: tandm, хороший откат компаниям Трампа, и им могут отдать почти весь национальный рынок. Типа протекционизм

3piO: beecool, тут?

darkstar_: 3piO, не упоминай в суе))

tandm: darkstar_, он специально исказил ник )

3piO: darkstar_, я ему информер подготовил как он просил... может еще кто хочет участвовать в проекте...

darkstar_: 3piO, exe?

tandm: alpet, посмотрим как Трамп в следующем году будет помогать трейдерам повышенной волатильностью )

tandm: 3piO, ботнет набираешь? )

alpet: впрочем сейчас на нефти кмк рост заканчивается. Пора хороший корректоз устроить

3piO: Идея проекта такая - у меня есть прога которая показывает курсы на бтц-е и спред по всем парам. Ее можно допилить разными индикаторами, может в итоге сделать терминал. Прога бесплатная, работает на винде, линуке, маках. Раздаю соурс на питоне 2.7

3piO: если кому интересно участвовать, пишите запрос в лс

credent: 3piO, как можно стать счастливым обладателем исходников?

credent: а-а-а, вижу.. в лс

3piO: от юзеров жду предложения по улучшению, добавлению функций

lunahod: 3piO, а можно ссылочку

credent: предложния - учитывать объем кошельков/ордеров владельца, при подсчета курса пар

3piO: для запуска нужно скачать питон 2.7 и проинсталить. Потом просто двойной клик на файл

3piO: credent, твое пожелание слишком неконкретно, точнее говори что хочешь

3piO: на линуксах вроде питон 2.7 уже встроен

darkstar_: там иксы нужны, да?

3piO: darkstar_, я не в курси про иксы, но вроде нужны - там окно

darkstar_: в смысле без графического интерфейса не запустицо

3piO: если кто писал на питоне для андроида - прошу поделится опытом, я хочу это и в телефон запихнуть

3piO: darkstar_, если tkinter работает без иксов, то запуститься

alpet: почти 5000 битков в долларовом стакане. Наверное и в самом деле готовиться шикарный слив

darkstar_: 3piO, ща узнаем. ставлю пакеты

3piO: я там сурсы шлю, так что все могут посмотреть что там. Код не длинный

darkstar_: _tkinter.TclError: no display name and no $DISPLAY environment variable

darkstar_: не проканало

3piO: и еще - не ругайте за стиль программирования, я это для себя писал

darkstar_: это дело каждого

3piO: darkstar_, я могу и для командной строки сделать если надо, так даже проще

darkstar_: да. не, зачем. может найду линуксбокс с графикой. либо пайтон для венды

3piO: darkstar_, а бровсер ты как запускаешь без иксов? ведь ты тут читишь ))

3piO: *чатишь

darkstar_: дык десктоп у меня на винде ж

3piO: darkstar_, так на винде это тоже работает, тока питон 2.7 проинсталь

darkstar_: ща вспоминаю на какой виртуалке у меня был пайтон установлен)

3piO: www.python.org

3piO: но берите версию 2.7

darkstar_: /downloads

credent: 3piO, прикольно!

credent: ракета ))

darkstar_: насчет requirements я понял)

3piO: credent, там стоит 5 секунд задержка, какая ракета ))

credent: пиктограмма

credent: у меня

darkstar_: http://imgur.com/a/lxMN5

darkstar_: и чо как он торгует?)))

3piO: darkstar_, вижу запустил. Он не торгует пока, он тока информирует. А вот что туда добавить и как - это вы мне скажите

darkstar_: цветовая кодировка. вопрос. когда зелененькие цифры это хорошо?

3piO: darkstar_, зеленое - число больше чем было, красное - меньше.

darkstar_: больше/меньше относительно чего? какой период?

3piO: darkstar_, относительно последнего значения. Цикл раз в 5 секунд

darkstar_: ааа. отоноч.

Webnode: 3piO, да что тут сказать по добавлению стратегии - покупай дешево, продавай дорого! и так много-много раз, с капитализацией прОцентов, это же элементарно!

darkstar_: btc/usd спред 0,00%

3piO: darkstar_, хочешь знаков больше за запятой?

darkstar_: думаю нет смысла больше

3piO: Webnode, нет проблем это добавить. Тока ты определи термины "дешево" и "дорого"

darkstar_: биток по 766 дорого, по 1500 - дешево))

3piO: darkstar_, это добавить ваще не проблема ))

darkstar_: :D

3piO: если кто тока что пришел - я тут раздаю прогу информер бесплатно. Сурс на питоне 2.7. Кому надо, просите в лс

3piO: *соурс

3piO: если есть пожелания по улучшению/добавлению фичь, то просите, может и сделаю

tandm: 3piO, индикатор предпампового состояния форков. с техническими подробностями - к лунаходу )

3piO: tandm, нет проблем - тока пришли мне формулы

tandm: 3piO, с формулой и я смогу )

3piO: я давно понял, что программировать фриваре в команде - это гиблое дело. Но я надеюсь, что можно заниматься системным анализом для фриваре в команде

darkstar_: 3piO, помницо какую то еще характеристику для пар вычислял.

3piO: для тех, кому не понятно - программировать - это написать некую последовательность команд для компа. А системный анализ - это что именно надо писать

3piO: darkstar_, когдато давно был обратный курс

darkstar_: нет. недавно

darkstar_: типа волатильности что то

tandm: darkstar_, там про обороты было

darkstar_: да, что то вроде этого

tandm: ликвидность

darkstar_: коэфициент ликвидности

3piO: darkstar_, я тут постил ликвидность по валютам. Но это моя версия там тааак всё навароченно, что не хочу палить ))

darkstar_: йех))

tandm: darkstar_, про нову можно захардкодить этот коффиециент

3piO: darkstar_, могу и в это добавить, давайте формулы

darkstar_: их нет у меня

3piO: darkstar_, у бикула точно есть ))

darkstar_: у него одна формула

darkstar_: жизнь = боль

3piO: darkstar_, и у той формулы одна извилина ))

3piO: darkstar_, но быть может, через боль надо зарабатывать?

tandm: 3piO, предлагаешь ему сменить ориентацию )

hazarun: 3piO, У меня должна быть где то формула для ликвидности. Где то валялась книга Шульца 1 000 индикаторов для фондового рынка. Но это - не крипта. ((

3piO: hazarun, а крипта чё, не валюта?

tandm: hazarun, кстати, пересечений для крипты много

darkstar_: первый форк информера))) http://imgur.com/a/DDV8J

tandm: проблема в том, что любой индикатор каждый реализует по своему )

darkstar_: объемы не те видимо для формул

3piO: darkstar_, ха! добавил десятичный знак для спрэда ))

hazarun: tandm, Не сомневаюсь. Пересечений - много. Есть ведь и различия. Впрочем, с формулой волатильности, пожалуй мало.

tandm: 3piO, еще похоже сделал монохромную версию )

3piO: а как правильно на русском - спрэд или спред?

hazarun: 3piO, И так и так

3piO: по идее должен быть спрэд

tandm: 3piO, древние русичи использовали спред

3piO: tandm, а как древние русичи называли валюты и пары? ))

hazarun: 3piO, В своё время, смотрел насчет слова Карате. В одном академическом словаре через Е, в друн

hazarun: в другом Э

darkstar_: 3piO, This code is delivering as it is вроде так пишут This software is provided "AS IS" and blah blah blah

tandm: 3piO, это я режим бикула включил, если кто не понял ) он под что угодно подведет теорию )

3piO: darkstar_, Спасибо, исправлю

darkstar_: 3piO, можно заюзать эту https://opensource.org/licenses/MIT

hazarun: tandm, Ты взял у Кеноби прогу ?

tandm: hazarun, взял

hazarun: тоже что ли просить...

3piO: darkstar_, не, мне не нужна лицензия, я просто отдаю как есть. А предупреждение - для того, что ктото не засунул флешку с прогой в анус и потом мне не предьявил иск ))

darkstar_: 3piO, в этой лицензии вроде так и написано)

3piO: darkstar_, думаю, одного предложения достаточно

darkstar_: 3piO, и строчки sorry выкинуть нафиг

tandm: hazarun, учти - там латвийский файлообменник )

hazarun: tandm, Думал попросить, да вот не пойму, Зачем...

3piO: darkstar_, не, это маркетинг... мол нищий программер из банановой республики чтото написал, может кто пожелеет и продонатит )))

darkstar_: use the source, Luke :D

tandm: hazarun, хотя бы глянуть, как кеноб пишет...

darkstar_: мир сошел с ума, кенобу нужен донат. жечь купюры чтоли?)))

hazarun: tandm, Как может, так и пишет. Чего время тратить то... ))

darkstar_: да, лучше с бикулом про лифт трепацо))

3piO: darkstar_, краейки соберать не будешь - рубль не накопишь )))

3piO: *копейки

tandm: darkstar_, а ничо так доната накидали ))))

3piO: я еще помню слово копейки! ))

darkstar_: tandm, ))))

hazarun: tandm, Питон освоить... Зачем он нужен ? Лучше Джаву.

darkstar_: tandm, сработал маркетинг))

3piO: я не помню, что получал донаты, хотя иногда кидал свой софт... просто интересно - а вдруг! ))

bitsotik: Вечер добрый )

3piO: всё я выпал в осадок - сотик пришел

bitsotik: Вот мне интересно как теперь вы на баксе взлетать то будете? )

darkstar_: hazarun, дык поразмять моцк фукнциональным програмированием :)

bitsotik: Всё, братцы, племяш пришел будем че-то с системой мутить, восьмерку на семерку перебивать вроде. Всем удачки

tandm: bitsotik, скажи скороговорку: манипулятор манипулировал-манипулировал, да не вынеманипулировал )

darkstar_: tandm, я и грю. зачем донат) деньги жечь шта ли))

bitsotik: 3piO, обана, куда так ты выпал ? Прогу-то хоть пришлешь глянуть? Ваяние ваше )

hazarun: darkstar_, Размять моск если, лучшее осваивать Пролог или Лисп. Мозг - не только разомнется, но и сомнётся поначалу. ))

bitsotik: tandm, манипулятор отманипулировал.

darkstar_: hazarun, по мне это уже мертвые яп

tandm: darkstar_, лисп очень даже жив

darkstar_: да, возможно

darkstar_: узкоспециализированное по

darkstar_: в autocad насколько помню он используется

hazarun: darkstar_, Там другая парадигма мышления при программировании. Тяжко.

darkstar_: hazarun, ну дык) я еще с универа помню

tandm: darkstar_, лисп или то что там парадигма другая? )

darkstar_: tandm, лисп

darkstar_: короч у меня ассоциации с латынью

hazarun: tandm, Не пробовал въезжать в Пролог или Лисп ?

darkstar_: знать якобы круто, но на деле набуй никому не нужно)

tandm: hazarun, пробовал в обоих. тяжеловато. а так как до практического применения не дошло, то бросил )

hazarun: darkstar_, Ага, то что такое не нужно, ты прав.

becool: hazarun, Почему я к тебе должен хорошо относится?

darkstar_: ща итак все бурно развивается

darkstar_: знать как базу конечно полезно

hazarun: tandm, Вот вот... Тяжко. Питон же - не из ихней семейки, Лиспа и Пролога ?

darkstar_: лан. чойта я. расфилософствовался

tandm: hazarun, питон проще. хотя и там навертеть можно )

hazarun: becool, А где я говорил, что Ты должен ко мне "хорошо относится" ?

becool: hazarun, Было всё нормально, вдруг ты о себе возомнил что ты крутойи успешный видимо, а я мол больной

becool: hazarun, Ну я то к тебе хорошо относился и не понял такой перемены

darkstar_: becool, hazarun покруче тебя всяко)

hazarun: becool, Ты прикалываешься ?

becool: darkstar_, мнение ашкольника даркстара конечно авторитетно

darkstar_: есстессно

becool: hazarun, нет не прикалываюсь

darkstar_: )))

tandm: darkstar_, смотря по какому критерию сравнивать ) если в килобайтах в чат - бикул адназначна чемпион )

hazarun: becool, Забей. Шутить я люблю.

darkstar_: tandm, в том в чем измеряется адекватность :)

darkstar_: так же можно оценить - бикул шутить ващпе не умеет)

tandm: darkstar_, мегабикулах?

darkstar_: а чуйство юмора - признак ума)

darkstar_: а негодуе - признак пролетариата))

darkstar_: угнетенного

becool: tandm, Смотри, вот он вот эти шутки считает умными, а п мне они глупо выглядят

hazarun: виноват

tandm: becool, каждый имеет право на свое неправильное мнение )

becool: tandm, ТО есть по его мнению если он школьник то он не пролетариат?

becool: я не пролетариат, я школьник --- капец логика

tandm: becool, школьник не может быть пролетариатом. потому что не работает

becool: tandm, так то да, но выпендреж с эотго это нечто))

becool: tandm, Еще неизвестно кем он будет когда школу закончит, может наркоманом)) Или еще что

tandm: becool, скажи, что в жизни делает тебя довольным?

becool: tandm, Моежет в колонии потом будет сроки мотать

becool: tandm, кгда не задаюттаких вопросов

hazarun: becool, Говорят к нам зима пришла ? Вроде обещали в Лен. области - 23

darkstar_: becool, )))

hazarun: becool, Выдохни. Забей. Расслабься. Отдохни вместе с нами. ))

darkstar_: это врядли получицо)

becool: hazarun, А ты тоже в ленобласти? Я думал ты в другом месте

3piO: becool, я тут для тебя програмку подготовил...

hazarun: becool, Да, я в другом месте. Но европейская часть РФ не большая. У меня, тоже что то подобное будет. Зима пришла.

becool: tandm, У нас с хазаруном более менее нормальный разговор, свой, тут влезли вы со своими шутками прибаутками тролингом, и ты доебался с вопросом почему я злой на этот твой уродский тролинг который уже задостоебил своим повторением 1000+ раз. так с хера ли я должен отвечать весело?

tandm: becool, Выдохни. Забей. Расслабься.

darkstar_: becool, Выдохни. Забей. Расслабься.

tandm: флешмоб? )

3piO: блин, а я для бикула старался... а ему не надо

darkstar_: это ж биржа)

becool: tandm, Чтобы человек нормально отвечал надои разговорынормальные, а не один и тот же билильный вопрос 1000 раз, ты как бухнул у тебя всегда мучает этот вопрос? Почему ты его задаешь только мне? И моя неготиная реакция тебе вновь и вновь нравится что значит у меня негатив а у тебя позитив?

darkstar_: все. клаву пора менять.

becool: hazarun, у меня тепло пока, но я немного уеплился

becool: 3piO, ты же не для меня, а для клиентов кому надо тоже самое

tandm: 3piO, ему могут помочь две программы: программа реабилитации хронических пессемистов и программа format.com

3piO: becool, не, специально для тебя делал...

becool: tandm, А тебе может что помочь? укол в жопу и раздробление черепа?

becool: tandm, Нахрена говном бросаться когда можно нормально жить?

hazarun: becool, Утеплился и хорошо. Для этого тебе и сказанул, впрочем.

tandm: becool, у всех в чате возникает тот же вопрос

3piO: tandm, он не песимист

becool: hazarun, одну стену чуть чуть и не до конца, но минватой

becool: tandm, а что еще у всего чата возникает слово хомяк? А тыхомяка тут видел реального?

tandm: becool, я пытаюсь убить в себе хомяка

3piO: becool, ты спросил, я сделал. А счас тебе пофигу, будешь о другом ныть?

becool: tandm, Ты транслировал вброс хмао, который он сознательно повторял изо дня в день, к которому примкнул ии начал тоже повторять стукач и с генными проблемами толстяк гей недовчока

darkstar_: 3piO, форк для бикула) http://imgur.com/a/h3EXQ

tandm: becool, вот эти подробности я только сейчас узнал. честно

becool: 3piO, Я не зна что ты сделал

3piO: darkstar_, точно! )))

becool: tandm, Нутак правильно, по уму то оно всегда сложно, зато проще по ветру, поветреным быть да?

3piO: becool, так я тебе предложил, а ты меня проигнорировал...

becool: tandm, Что-то хуз писал постоянно его гнобило, что-то еще кто-то, кто-то для чего-то что-о пишет каждый день, и этим всех заражает, еще и с шутками прибаутками вот как даркстар например

3piO: а так пел, мо то надо, это надо... а когда до дела дошло, то ...

darkstar_: этот пролетариат даж не сможет запустить прогу)

tandm: becool, представь, что каждая буква стоит 1 нову...

becool: tandm, Ты копируешь потому что что? Потому что весело или потому что думаешь что правда? А у него обида какая-то на самом деле вот он и плюётся гадостями каждый день

hazarun: 3piO, Спред там, по простому считаешь ? Не учитывая объёмы ?

darkstar_: бикул вам в наказания

becool: 3piO, Считай что хочешь

3piO: hazarun, по простому. Но могу добавить по сложному, если даш формулу

becool: 3piO, Вода катится с горочки, и ты тоже скатился на тот результат котрого хотелось

tandm: becool, он - это ты? Вообще-то у нормального взрослого человека уже должна сложиться определенная самооценка и на мнение других ему по большому счету должно быть пофиг

becool: 3piO, Иногда бессознательное становится выше сознательного

i_iv: https://www.youtube.com/watch?v=OZbTsVBYEok

becool: 3piO, Точнее очень часто

3piO: becool, так чё же ты ныл, если даже не хочешь глянуть на решение? Для того, чтоб ныть?

hazarun: 3piO, Не, мне не нужно. Как мне хочется, я и сам посчитаю.

becool: tandm, Ну наконец-то ты понял. ну так вот и обрати внимание сколько тут в чате говна недоличностей, если это говно каждй день плёется что бикул нытик, ну пусть нытик, нахера это говно плюется то каждый день?

3piO: hazarun, ну да

becool: 3piO, ты сейчас скатился нато для чего реально это делал, для того чтобы написать всего одно предложение и дальше что не ответили в три секунды упрекать

becool: 3piO, Так себя ведет тот человек кто делает вид что хотел сделать но на самом деле не хотел, но сделал

tandm: becool, если бы так бурно не реагировал, тебя бы никто и не заметил. а так - 80% чата - ты. поневоле всем приходится с тобой общаться )

becool: tandm, нт не воли, есть недоличности

3piO: becool, вобщето полчата уже прогу запросило и попробывало... а ты тут опять ноешь

tandm: 3piO, некогда ему... недоличностей травит )

becool: tandm, Был бы повар вы бы с поваром трещали, потому что ведомые недоличности, и то что ничего хоршего сказать не можете а мычите негатив и всеравно пишете это показатель

3piO: tandm, ))

darkstar_: короче чатик не потонет)

becool: 3piO, Ты забыл что я в бане был? Да и для чего мне раньше нужна была твоя прога если там этого не было?

becool: 3piO, Ты ведешь себя агресивно, и поэтому прогу свою мне не втюхаешь

3piO: becool, а отвечать за свои слова можешь? Ты спросил, я сделал, а ты даже не посмотел... отвечай!

tandm: becool, у меня иногда возникает идея написать программный имитатор бикула. словарный запас известен, материала для анализа - более чем достаточно )

hazarun: becool, А кто тут недоличности ?

becool: 3piO, Что отвечай? Я спросил есть или нет, тогда не было, ну теперь пусть есть, с чегоя сказал чотбуду качать? Нет

darkstar_: tandm, по апи можно подцепицо

3piO: tandm, на лиспе это должно быть просто

becool: hazarun, Тех кого цепляют все кто в чате пишут)) Причем чем свободней пишут тем больше цепляет. Свобода может как числом сообщений выражаться так и содержимым.

3piO: becool, ты понимаешь, что ты показал себя в чате треплом? Не тока показал, но и доказал.

becool: 3piO, Где я тебе сказал что скачаю твою прогу? Говори за себя пиздабол что ты а не я

3piO: а давай всем чатом скинемся на бабу для бикула?

becool: 3piO, То как ты сейчас гонишь на меня что я тебе мол что-то там просил и что-то там сказал ты пиздаболишь, не было такого нетого не другово

darkstar_: 3piO, не. я гроша ломанного не дам.

tandm: 3piO, на резиновую или из стекловаты?

becool: 3piO, я тебя не о какой проге не просил и того что скачивать буду пробовать тоже не говорил

3piO: darkstar_, а я добрый, я бы дал... но еще организовать надо... а еще надо найти такую, которая его нытье выдержит

becool: 3piO, Я тебе это нормальными словами долго пытался объяснить но ты не понимаешь нормальных слов и еще и начал на меня наговаривать еще и свыше

evsd: бавайте ск орей зачем почему

hazarun: Весёлый и задорный у вас тут срач, пацаны. ))

darkstar_: а чота помницо на днях было. бикул ты проявлял интерес к разработкам кеноба

becool: 3piO, Если тебе что-то там увиеделось. тебе что-то там захотелось а потом ты что-то там решил от так и называется

darkstar_: так что не надо ляля

3piO: becool, ты подумай что ты сказал... спец по теории информации не понимает твоих слов... это тока значит, что с твоими словами чтото не то...

becool: 3piO, Ты написал прогу для самого себя по моему описанию что я писал в чате, вот так это называется, потому что я тебя не просил мне писать прогу

sooo: да тут давно уже конструктивные беседы не ведутся

becool: 3piO, считай что хочешь, но я у тебя никаких прог писать не просил, и скачивать не обещал

darkstar_: деструктивные

evsd: бикул оюосновывает, это важно

becool: evsd, ))

3piO: а у нас снег опять. А у вас?

darkstar_: чтобы кеноб посчитал ему нужны формулы)

He3Hauka: подскажите пожалста,сутки назад отправил средства,но они так и не поступили на адрес.

hazarun: sooo, Какие конструктивные беседы ? Тут тролл бокс..

3piO: darkstar_, )))

becool: evsd, А что бикул обычно обосновывает?))

He3Hauka: есть ли онлайн поддержка? создал тикет,но там 3 суток на ответ(

evsd: becool, помоему ты притягиваешь чепуху

3piO: He3Hauka, смотри в блокчейне, может комсу мало дал

tandm: evsd, он ее генерирует

becool: evsd, я тоже заметил, это как-то на уровне эмоций, им как-то не с руки другим написать они пишут мне, и выговриваются)

hazarun: He3Hauka, С фиатом, кроме техподдержки, подсказать особо некому.

becool: evsd, На самом деле фигня в том что если писать другим то им надо что-то умное написать

becool: evsd, А когда человеку трудно написать что-от умное он просто пишет бикулу какую то фигню))

evsd: becool, если им понять то писать надо, а так

He3Hauka: техподдержка это сапорт?

3piO: becool, ... в отличии от бикула, он пишет фигню постоянно ))

3piO: He3Hauka, да

darkstar_: He3Hauka, да. можно в чате написать admin или support12

becool: evsd, в этом и есть вся суть бикула, повара и т.д., потому что основной контингент тут испытывает проблемы с реальным общением и без таких связующих людей сами друг с другом не смогли бы общаться))

He3Hauka: уже сутки средства не зашли,а еще трое ждать только ответа...это ппй как долго

darkstar_: 3piO, рекурсия по бекулу?

darkstar_: He3Hauka, какие средства?

3piO: He3Hauka, ты в какой валюе слал?

evsd: мне кажется проблема в фрейде

3piO: darkstar_, она ))

He3Hauka: вывод на адрес битков

evsd: тоесть ебаться здорово, неит так нет

becool: evsd, да, и ты умный что это всё понял, я не сразу понял это всё, почему они мне столько фигни писали))

He3Hauka: Вывод BTC на адрес

tandm: becool, т.е. твоя миссия - выступать коммуникационным клеем? похоже )

darkstar_: He3Hauka, в блокчейне смотрел по адресу кошелька или транзакции?

evsd: becool, тперпение

darkstar_: кошелек получатель - синхронизирован с сетью?

He3Hauka: 1GwXKwiBhx5VngYQ4umAb9QsTW9xxEre7P

3piO: He3Hauka, вывод от сюда битков? Должны были уже прийти. Или смотри в блокчейне, или ты адрес неверный вбил

becool: tandm, ну да, только не перебарщивать главное, иногда клея слишком много)

He3Hauka: нифига не зашло,смотрел конешн

darkstar_: He3Hauka, нету инфы по данному адресу https://tradeblock.com/bitcoin/address/1GwXKwiBhx5VngYQ4umAb9QsTW9xxEre7P

evsd: обажаюю бухать и др

3piO: He3Hauka, https://blockchain.info/address/1GwXKwiBhx5VngYQ4umAb9QsTW9xxEre7P

evsd: в чем разница?

becool: tandm, Это ж сразу уже нормальное общение начинается, сначала то все вылезают обосрать бикула и только потомсмотрят кто пришел чего пишут))

evsd: пить и ибаца нельзя одному

tandm: becool, ну это ты сам такую традицию создал )

becool: tandm, Понаблюдай, человек пришел сказать нечего, видет бикула первые слова готовы, а потом уже к нему обращается другой о привет иты тут, да вот бикула обосрать зашел, а понятно, то есть бикул это как словао погоде

darkstar_: обосрать бикула это не роскошь, а средство общения

He3Hauka: ну так и я о том же - сутки прошли,а битки не заходят

3piO: He3Hauka, посмотри в истории тут, на какой адрес ты битки послал

becool: tandm, И сразу все довольны и веселы бикул нытик, а мы уже позитив получили как не нытики, ура, чего теперь обсудим))

He3Hauka: Вывод BTC на адрес 1GwXKwiBhx5VngYQ4umAb9QsTW9xxEre7P

tandm: He3Hauka, 11.12.2016 с 00:00 до 04:00 по MSK плановые технические работы, в этот период депозиты и выводы bitcoin могут быть временно недоступны

He3Hauka: подвердил по мейлу

darkstar_: He3Hauka, https://support.btc-e1.com/

becool: tandm, Бикул нытик, бикулбеден, бикул просрал деньги, у бикула пожар, бикул болеет, бикул вообще весь проблемный и негативный сборщик всего мысора, а мы все на позитиве хорошенькие белые

He3Hauka: так выводил 12го а не 11го

tandm: becool, почему ты хочешь об этом говорить?

3piO: He3Hauka, ты это в истории тут посмотел?

becool: tandm, Повара на вас нет просто

He3Hauka: да,скопипастил

becool: tandm, Повар бы вам задал жару

tandm: becool, еще сотика призови.

becool: tandm, Да, это полезные люди, они манипуляторы вами!

evsd: becool, помоему, что случилось

darkstar_: жог наркомана в бочке. он его проклял

becool: darkstar_, отккда ты знаешь об этом?

darkstar_: наркоман выжил

3piO: becool, еще раз. Ты тут этим утром долго говорил о пробеме... я предложил эту проблему решить... я вложил своё время и знания в решение ТВОЕЙ проблемы... а тебе пофигу... у меня логически появляется следствие - небе не нужно решение, тебе нужно ныть.

tandm: darkstar_, наркоманов нельзя жечь. можно надышаться дымом )

evsd: becool,нет, не наркоман, ошибка видна

darkstar_: becool, школота следит за тобой

tandm: 3piO, к нему подходят законы только нечеткой логики )

3piO: tandm, не, нечеткую логику я уже пробывал, не работает. Счас тестирую на формальную

becool: Новая волна нападения

evsd: darkstar_, даркстар обьясни, в сем всетаки проблема

becool: Наговорились друг с другом и переключились снова на общее?))

darkstar_: evsd, я в отклонениях не шарю)

evsd: darkstar_, это выходка, а серьезно?

3piO: блин, это сотик виноват! Это он заразил нашего бикула шизофренией!

becool: Бикул это бог чата?)

kaonashi: дебил чата

darkstar_: evsd, честно - хз.

tandm: becool, по крайнем мере ты себя так позиционируешь )

evsd: соток против

becool: О, скащал толстый анимешник с гендерными отклонениями

evsd: а это тоже важно

3piO: а я помню времена когда бикул был нормальный...

darkstar_: клаву поменять пора

evsd: darkstar_, тебе хитрожопость пора поменячть

bitsotik: tandm, нельзя сказать что чеье-то мнение не правильное или правильное. Оно просто имеет право на существование. Лишь истина всего одна.

3piO: я даже учился у бикула азам...

darkstar_: evsd, чо правда? ништяк что подсказал))

3piO: палундра! Не читайте! Сотик заразен!

tandm: bitsotik, каждый имеет право на свое неправильное мнение )

evsd: darkstar_, серьезно

darkstar_: evsd, объясни подробнее. чот я тебя ващпе не понял

tandm: 3piO, бикул, откати версию!

becool: evsd, ТО есть ты заметил туттого кто один из выкрикивающих из кустов

evsd: darkstar_, если не понял, то шутят

darkstar_: evsd, о чем?

becool: evsd, увонаши такой же тоже

hazarun: darkstar_, Он наверное ща бухает, и сам не понял. ))

becool: evsd, каонаши

evsd: молодцы

becool: evsd, Они ущербные люди просто и ничего другово не умеют и не могут, или школьники или выросшиене понятно что

darkstar_: evsd, так поясни о чем ты

evsd: два дибила, не надо мыла

becool: darkstar_, Скажи кому-точто-от умное

hazarun: Ага. Срач - знатный. Сразу много нитей идёт.

tandm: hazarun, многопоточный срач )

3piO: многомерный

becool: darkstar_, Начни свою тему, бикула то хватит обсирать, что умного скажешь?

darkstar_: becool, ты не пали свои ники) все забанят

3piO: becool, а может ты скажешь чтото умное? после стольких лет бреда...

becool: darkstar_, у бикула то фиговые темы, нытиковые и мало разнообразия, но твоих то кроме обсирания бикула не было вовсе, а ты уж тут два года, и не слова усного не сказал или 4 года))

hazarun: tandm, Да, что то я не профессионально выразился. Кстати, используешь многопоточность ?

tandm: hazarun, нет. так хватает

becool: 3piO, бред это для тебя и то там хоть какая-то тема

3piO: hazarun, я использую

becool: 3piO, а вот эти собачки вылезающие тяф тяф и снова в норку они вообще без возможности что-то сказть

3piO: becool, а ты прочитай что ты написал ))

darkstar_: becool, делать надо) а не флудить)

tandm: 3piO, он не читатель, он писатель )

becool: darkstar_, что ты еще умеешь тяфкать кроме в сторону бикула, ты тут не первый год и ничегокроме обсирания бикула не сказал))

caca77777: пучит от куни

becool: caca77777, как это?

darkstar_: becool, да, не. ты хочешь так думать)

hazarun: 3piO, Многопоточность - это гуд. ))

becool: darkstar_, а что ты говорил?

darkstar_: becool, мне побуй на тебя))

becool: caca77777, тебе куни делали илиты?

darkstar_: несколько раз тебе это говорил))

becool: darkstar_, зашорти, хватит буй уже

3piO: hazarun, согласен. Но у меня есть и боты, которым это не нужно.

becool: Хащарун хороший программист

darkstar_: зашортить бикула

evsd: Бикул уважаемый человек

3piO: darkstar_, ++ ))

evsd: тупой, но есть свое мнение

caca77777: becool, очим чирищюр гг

evsd: becool, как можно спорить со сдадом? цап цабе

becool: caca77777, ты бот?

becool: Сдклайте уже кто-то бота для чата! Алису!

tandm: скорее кот

3piO: becool, я же предложил тебе бота. А ты отказался.

becool: 3piO, А ты и обиделся, маленький?))

tandm: 3piO, он сделал комплимент твоему возрасту )

3piO: becool, когда я свой маленький введу в тебя, ты почуствуешь какой он маленький )))

3piO: tandm, точно!))

becool: 3piO, Вот поэтому я твой софт и не качаю

3piO: becool, правильно делаешь - тогда отпадет причина ныть

becool: Опасный чат, кто-то руки в лицо хочет засунуть, а кто-то и...

evsd: гворят скоро будет новый конкракт в эфире

evsd: шутки больше не катят

becool: А потом еще некоторые удивляются почему ни с кем встретится не хочешь с чата..

caca77777: becool, чирищюр

tandm: becool, кеноб говорил про маленький 17дюймовый ноут, а ты про что подумал? )

becool: evsd, Ну да, вот он уже зашел, с ником кака

3piO: а может это цаца ))

tandm: бикул везде каку увидит )

hazarun: 3piO, А может и Саса. ))

becool: А как это он или она?

becool: Я вчера селитру купил так что горюч и опасен не шутите мне тут)

becool: Имею взрывной характер!

darkstar_: надышался паров

3piO: террорист детектед!

becool: да, есть чуьт чуть

Aleksandrovich: дымить будешь

hazarun: becool, Я удивился, где ты калийную нашел ?

becool: Не. я не террор, я нг

becool: hazarun, В оби, пол кило 60 или 70 рублей

3piO: becool, не ври, я не продавал тебе взрывчатку!

hazarun: becool, Не в смеси ?

3piO: ))

becool: hazarun, там же взял и серные шашки именно климат или как они синяя пачка, ФАС тоже брал в кастораме, они более твердые говорят, уголь еще нужен и весы электронные

tandm: 3piO, обиполкилоби

3piO: tandm, )))

becool: hazarun, Нет, нахрен мне смеси, слушай, сейчас найду тебе как выглядит

hazarun: не надо

3piO: tandm, счас уже обиполлитрови... хотя нет, уже 0.7 ))

hazarun: 3piO, Тандем небось уж перегнал тебя

tandm: hazarun, я не пью

evsd: нужны ребята биткоин 800

becool: hazarun, www.obi.ru/udobreniya/selitra-kalievaya-buiskie-udobreniya-0-5-kg/p/3371705

becool: hazarun, 79 рупей пол кило

hazarun: tandm, Сейчас не пьёшь ? Или вообще ?

3piO: tandm, не пьешь? А как же ты его во внутрь доставляешь? Клизмой? )))

becool: hazarun, в кастораме тоже есть но маленькие совсем пакетики по 10 грамм, но и не очень дорого 7 рублей за 10 грамм

evsd: к стаи без этого, прикольнулись с рублем

tandm: 3piO, кого его? алкоголь? 3 дня трезвый уже )

becool: hazarun, То есть по 20, да такую тоже куппил

becool: hazarun, Уголь теперь надо купить древесный

tandm: hazarun, решил до нг завязать а там посмотрим

hazarun: tandm, Понял

becool: tandm, с феерверками до нг завязать?

becool: hazarun, Мне не нравится монополия фирм феерверков

becool: hazarun, на 5млн питер только 2 фирмы продающие феерверки!

evsd: каждый себя увжающий критптовалютчитик сказал

becool: hazarun, Они никого больше не пускают и вот уже 10+ лет цену взвинчивают

hazarun: becool, А мне не нравится, если за всякие такие штуки, пойдёш по делу, на несколько лет. ((

tandm: becool, накажешь монополистов?

becool: hazarun, Кроме того там еще зависит от калибра класс опасности но и феличина феерверка как бы, разлета буха

becool: hazarun, Говорят чтобы менты не приняли если куда пойдкшь не возле дома там то сё надо короче в подарочную упаковку делать чтобы красивее смотрелись

evsd: что 800 будет, но кто его купмл по 500

becool: tandm, Монополисты классного феерверка и не делают калибка 50

tandm: becool, двухсотлитровая бочка, перевязанная красной ленточкой )

hazarun: becool, В юности-молодости я всяким таким баловался. Ща - ну бы его нафик. Дюже серьёзно нынче к этому относятся.

becool: tandm, у них максимум 30 а у тебя в городе можно купить фееверк болеечем 30 калибра?

evsd: becool, не злись

becool: hazarun, а то что от этого серьзно и цены на феерверквзинчены ты не думал?

tandm: becool, я обычно смотрю как другие во дворе запускают. так дешевле )

becool: tandm, да хочется как горобской забабахать

becool: tandm, у других калибр тоже всего 30, они маленькие

becool: tandm, чтобы забабахать реальный салют надо тысяч 50-100 минимум

hazarun: becool, Ага. Я уже вышел из возраста фейерверков. Баловство.

becool: tandm, И в фирму обращаться

becool: hazarun, Не, ты что фестивалить обязательно надо))

hazarun: becool, Ну, если есть желание - дело хорошее.

becool: hazarun, чувак они тут думают сексом запретить заниматься более чемдва раза в неделю, ты имбольшеподчиняйся

evsd: селитра и магнию

evsd: бомба что бы все в мире жили

becool: hazarun, А то прямо в совесткое время каждый второй школьник разносил пол девтяиэтажки, да?

hazarun: evsd, Марганцовка и глицерин.

becool: hazarun, Ты же должен понимать кого и что они на самом делезащищают

becool: hazarun, Людей становится больше и они защищают новый мировой порядок, порядокбольшегорабства

evsd: hazarun, маргонцевка в тюбеках, а селитра в мешках

becool: Слушайте, а из арматуры стекловолочной можно тоже ствол выточить?

becool: Или только из металической?

evsd: лубо реьенок это знает

becool: Иначе нахрена ее селали изобрели..

becool: мнеться, геться топором рубится это хорошо, а дальшето что в жопу ее засовывать чтоли

becool: Я думаю разорвет ее от пороха даже если с двойным запасом выточишь?

hazarun: becool, Хорош такими темами чат палить.

becool: Хотя кто-то ж там делал на 3д принтере который реально стрелять мог, так что так наверно тоже будет стрелять, только малым калибром

evsd: скоро новый год

hazarun: hazarun, Точнее палить и чат и биржу. Где лежат мои и твои деньги. Не нужно таких тем здесь.

evsd: и взрыв пакеты все было и ракетки,

Tuesha12: измельчали людишки, 100 лет назад на броневик лезли речи толкать, а сейчас шизоиды в чат пишут

evsd: а сейчас дауны в доруг жруга

evsd: от кошка бросила котят, до сирия виноват

tandm: кошка бросила котят - перестаньте какать в чат

tandm: becool, давай про генераторы лучше? велосипедным ноут заряжать получится, прикидывал?

hazarun: tandm, Какать - еще ладно. А вот палить чат - не нужно.

evsd: tandm, у меня дома кошка с котятамит

evsd: hazarun, кошак на причем, тоже котенкам брался

evsd: от и пойми, где

hazarun: evsd, это здорово

becool: ушел утеплятся дальш

evsd: не все гда котенок виноват

3piO: не, давай скинемся на новую клаву для бикула

tandm: 3piO, легко. только кнопки эпоксидкой залить надо перед тем как бикулу отдавать )

3piO: tandm, не, надо с тормозом, чтоб посты шли медленее ))

tandm: 3piO, тогда там буфер надо предусмотреть на пару гигабайт )

3piO: tandm, не, вобще без буфера ))

tandm: 3piO, идеально если бы он каждую букву майнил. и сложность постоянно возрастала )

3piO: tandm, ага )))))))))

hazarun: поржал

hazarun: Бекул - звезда чата. Звездец.

lunahod: мдя бикул на броневике с кошками в руке ))

3piO: я тут подумал... с бабами так - они жалуются на чтото, ноют... но мужик не должен стараться решать их проблемы, он просто должен выслушать, посачуствовать... психология у них такая...

3piO: ничего не напоминает? )))

lunahod: придёт скажет что опять тут его все обсуждают

hazarun: 3piO, мужиков ?

tandm: lunahod, поэтому надо придумать ему какой-нибудь псевдоним. Революционный. Овод - подойдет )

3piO: hazarun, не, у мужиков по другому. Они обозначают проблему и решают ее (по мере способностей).

lunahod: tandm, это я к чему )) Ленин тоже всё писал и писал

hazarun: 3piO, Психотерапевты, за это деньги получают. Выслушивают чужие проблемы.

evsd: какие добрые ребята

evsd: и тыпые, извините)

3piO: Это генетически - баба собирает грибы и ягоды, она не концентрирует внимание на одно. А мужик - охотник - он смотрит тока на дичь которую надо убить

hazarun: 3piO, Логично

3piO: hazarun, так, я надеюсь мне бикул пришлет донат за старания )))

lunahod: 3piO, мужик смотрит на бабу когда та нагибаясь собирает ягоды и грибы ))

hazarun: 3piO, Ты - его обидел.

tandm: lunahod, если только смотрит - это не мужик )

hazarun: ))

lunahod: tandm, ))))) хорошо присматривается

hazarun: tandm, Потому, никогда не понимал, смысл ходить в стриптиз бары.

evsd: три пидараса эфир не подвинут

3piO: hazarun, быть может это и была моя цель? ))

evsd: одного спасать надо

evsd: весь год здорово, потом не очень

lunahod: так уходи от них ))))

hazarun: 3piO, Подозреваю, цель была - повеселится. Сегодня - было весело.

evsd: ушел, но должны остались

3piO: hazarun, )))

evsd: hazarun, хазар?

3piO: как же мне хочется еще выпить... но завтра дела ((

sooo: нейм в рост пошел

hazarun: 3piO, До завтра - ещё далеко же...

lunahod: 3piO, лучше ссылку на программу в лс скинь

3piO: хотя... дела то с идиотами, с ними лучше говорить с похмелье, когда мой мозг опускается до их уровня...

sooo: какие мы высокомерные :)

tandm: 3piO, будешь тюнинговать мозг до уровня обезьяны? )

hazarun: evsd, Ты чего то спросить хотел ?

evsd: hazarun, чурка или нет?

hazarun: evsd, Хороший вопрос.

3piO: tandm, я стока не выпью )))

evsd: hazarun, еврей понял

tandm: evsd, чурка - Чрезвычайный Уполномоченный Российской Красной Армии? )

hazarun: evsd, По твоему, хазарин - это типа татарин ? ))

evsd: hazarun, да,

hazarun: evsd, Твои предположения не верны. Хазары - это не татары. А я - русский.

evsd: любой татарин или хозарин понимает ращзничу

3piO: вобщето, руссий это не национальность исторически. Я серьезно.

evsd: чукчи вы, все)

3piO: *русский

evsd: даже ракеты не считаются

Aleksandrovich: 0.джэ

tandm: ладно, жители многонационального чата, я спать

hazarun: 3piO, Да, по поводу "русский" - дебатов кучи. Вообще , придерживаюсь мнения, что это суперЭтнос. Как арабы, китайцы , индусы.

3piO: hazarun, ну да, типа того. По такому определению и я русский

Butiful: может кто напомнит сайт, где в одном окне, 4 окна виздома

hazarun: tandm, Споки. У вас уже час ночи небось.

hazarun: 3piO, Да, на мой взгляд так.

lunahod: Butiful, https://hypron.net/bitcoinwisdom/

Butiful: lunahod, спасибо

sooo: lunahod, ваще красота

sooo: спасибо и от меня

lunahod: пользуйтесь

lunahod: опять значит ждём китай когда проснётся , чтоб слив начать

hazarun: lunahod, Начинай, Китай поддержит.

lunahod: hazarun, я уже весь в форках

hazarun: чорт

evsd: опять кокоето, чмо на кита надеется

evsd: их 150 милионов

evsd: нет

hazarun: evsd, Бухаешь ?

evsd: hazarun, отдыхаю после работы

evsd: а вы?)

hazarun: Ды вот, болтаю туточки.

hazarun: разошлись все похоже. Или уморились. ))

evsd: так и хочется конфликта

evsd: конфликт бывает и конструктивный

evsd: это пять, за дмпломнуую аботу

3piO: evsd, тебе в морду надо? ))

evsd: 3piO,это деструктивно

3piO: могу сконсруировать твою физиономию )))

evsd: 3piO, не сомневаюсь, на вас и доказывал

3piO: evsd, о! Какая честь!

evsd: 3piO, чепуха,

3piO: evsd, это я по твоему чепуху говорю?!! ))

3piO: ладно, наверно надо идти отдыхать...

evsd: 3piO, не важно, что ты гововоришь

hazarun: 3piO, Ща Бекул придёт. Утеплится там...

evsd: hazarun, У Бикула есть свое мнение, вам мышам сслушать

bitsotik: Мне кажется что еще не все денежки мне отдали. Рублик еще есть в наличии, надо еще ниже.

evsd: bitsotik, у тебя тоже

bitsotik: evsd, чего у меня тоже?

evsd: bitsotik, анзац

evsd: bitsotik, человек новый, но тебя идиотом называют

bitsotik: evsd, не-а, запятая

3piO: evsd, почему ты обижаешь идиотов?

evsd: bitsotik, согласен, это не важно

evsd: помоему все впорядке

evsd: bitsotik, на самом деле как дела?

jhsdf37: рубль пошел бить 60

evsd: jhsdf37, ото от 35 отбиться

bitsotik: evsd, ну так-то да. А дела в поряде. Вон сегодня пол класса моего академ по гитаре сдавали, в основнм все на 5.

3piO: вот так он мозги нам выносит: "в основнм все на 5". Так в основном или все?

evsd: bitsotik, здорово, у нас нет не гитаре играть, карате и футбол

bitsotik: 3piO, малыш, кто тут те че выносит?! С тобой ваще разговаривают или нет, ты мне скажи.

evsd: помню как гитаристы, без прикола играли косоглазые китайци, верещат в кустах как зайци

bitsotik: evsd, тоже хорошо. А у вас это где?

evsd: bitsotik, в Днепропетровске

evsd: ваня бей, а я прикрою

bitsotik: evsd, а-а. Карате не заниался. Айкид - да. А есть у вас там Айкидо?

evsd: лисицин то сбил меня

evsd: bitsotik, не знаю, у нас даже карате ушу

Kubrick: не китайцы, а вьетнамцы верещат

alpet: как-же далеко биток от 50 тыр. оттолкнулся. А до конца года остается 18 дней...

becool: Лисицын был тут в чате недавно

Aleksandrovich: alpet, а по китайскому)

alpet: у меня все адреса битка начинаются на 1*, а у Навального почему-то на 3*. С мультиподписью что-ли замутил

alpet: как-бы теперь биток окончательно не запретил, раз уж оппозиция эксплуатирует

evsd: глупости, от обратного биток скоро вместо рубля

kslavik: alpet, на 3 может начинатся адрес битков - их меньше но они есть

ka50hokum: что-то скучно на графиках...

alpet: вот отправит пресловутый госдеп ему 1000 битков, и как потом население будет настроено против криптовалют? )

evsd: скоро будет поодоваться, то что осенью куплено, новый год

hazarun: alpet, Проблемы будут с оналичиванием. Не будет же он битками расчитываться.

bitsotik: Ну а где работа фейка насчет 12 числа? )

Aleksandrovich: 13 вроде

bitsotik: Aleksandrovich, ну хорошо. Но даже и 13 уже подходит к концу.

Aleksandrovich: bitsotik, это если 13)

bitsotik: Значит слабый фейк, придумайте что-нибудь поинтереснее, и не стоит пенят на графики и говорить что скучно. Если скучно надо играть в картишки например с друзьями по разуму

traider11993: закупаться лайтом?)

credent: да, счас закуп актуальней

evsd: надо ждать

evsd: или учиться ждать если чешеться

credent: можно и переждать

credent: потом догонять сложнее

evsd: credent, сложне нетерплячку окупать

credent: evsd, уточню, нужно знать, чего ждать

credent: а если не знаешь, станешь ждуном

credent: будешь наблюдать, как цены мимо пролетают

evsd: кстати, а чего ждем?

credent: ты сам сказал - ждать

credent: я хз

evsd: все правильно, главное терпение

evsd: анегдот

evsd: приходит терпила к милионеру

credent: Если долго сидеть на берегу реки, то можно увидеть, как по ней проплывет труп твоего врага

evsd: credent, все правильно ждать

credent: извини, перебил

credent: evsd: приходит терпила к милионеру

evsd: и спрашивает

denn2013: credent, Или сам раньше с голоду помрёшь

credent: denn2013, я не жду, пока передохнут мои враги, пусть живут! я их даже уважаю ;)

credent: denn2013, пережить или не пережить кого-то, не самое важное в жизни..

becool: А бедный повар всё в бане и в бане!

credent: evsd, я так понимаю, смысл анекдота, пока кто-то спросит...

becool: credent, кто спросил тот и терпила))

credent: becool, браво

becool: У каждого россиянина есть законное право быть терпилой!

credent: becool, опять на россию переводим стрелки

credent: becool, в других странах терпил не бывает

becool: credent, Извини, ты прав, пойду в магаз лучше, а то сейчас как у кого-т засвербит задать пару вопросов и стать терпилой моих ответов))

credent: becool, за пивом?

Aleksandrovich: они тока болтают,а русские -делают дело.

becool: credent, Мысль конечно, но нет, бухать не хочу, так, за хавчиком

credent: becool, возьми сразу и водки, чтоб два раза не ходить

becool: credent, Не, я обычно много хавчика беру

credent: becool, да шутю..

becool: credent, во , вспомнилза чем яна самом деле, уголь древесный еще купить

credent: becool, шашлычек?

alpet: рублю буквально тютельку остается до 60, и при этом 2 дня до экспирации опционов, даже меньше

becool: credent, можно правда и самому его произвести , но я хочу как положено чтобы технология понимаешь, потом может как нить и со своим попробуем

Allexx: becool, уголёк для мойшины уже покупаешь?

becool: Allexx, в машину я дунул там один шомпол сдвинулся, надо бы котел паровой делать, вот на этом и отложено, ну и спицы приделывать к этим, нутыпонял

becool: credent, шашлычок, да, новогодний

credent: becool, молодец!

becool: credent, селитра, сера. уголь древесный, тщательно раздробить перемешать в пропорции , и в презервативе свинье в жопу, и фетиль, и свинью отпускаешь побегать на соседский участок))

becool: Шашлык с доставкой))

credent: becool, ужас.. ты не маньяк? а то я в Питер собрался, хотел к тебе в гости напроситься, но вот теперь как-то сомневаюсь ))

becool: Но главное чтобы не как в фильме было с кошкой или собакой, американском, как там то на почту побежал то в магазин))

becool: credent, не я с тутошними не встречаюсь, они такие психи

credent: becool, ну не хочешь, как хочешь.. я бы рыбки к пиву привез

becool: credent, насчет рыбки я тутв один магаз ходил ибрал у них один половину рыбы)) Причем магазин проходной у метро))

becool: Эот когда хмао орал чот я многобутылок пива купил, так на месяц было. Так вот оони там дико скучают без меня теперь.

credent: becool, я наслышан, что у нас в Крыму рыбы меньше чем у вас в Питере

evsd: пластованой, когда разрезают с пуза

becool: credent, ну много продают рыбы, а как же

evsd: если карась или лящь, так правильно

becool: credent, А зачем тебе в Питер, ты же не беларус

credent: becool, я давно был в Питере, а потом в Париже, и нашел много общего, вот и хочу убедиться в правильности своих юношеских воспоминаний

credent: только не понимаю, при чем тут Беларусь

becool: Потому что из Беларуси нормальные люди приезжают которым интересна архитектура молодые.

becool: credent, А ты немолодой видимо что с Крыма и то что ты говоришь в юнности

evsd: наооборот, со спины иджелать надо

becool: credent, Ну да ладно, опять выходит о России типа, словно блин а сами то в США или еще где живем

evsd: что бы вся икра и модоки и жир осталсь,

credent: becool, да.. староват уже, по моей памяти в Питере много чего от Европейкой архитектуры, и скульптуры в лувре и в Эрмитаже те же.. а вот в париже почти вокруг каждого дома кафешки, люди там не готовят, спускаются пожрать.. думаю, что в Питере не так, и скорей всего более тусклые краски

becool: credent, Как мне одинваш бывший соотечественик заявлял который с Днепра, но не Киев, что музеи театры и прочее это понты, а у него во дворемолшашлычок вот это тема, и никаких там не надо понтов, друзья приходят

becool: credent, вот тебе современный украинец или россиянин, если молодые

evsd: becool, с Киева извини хоть тво и друг, нельзя верить

credent: becool, у меня друзья в Киеве и в Мукачево

credent: becool, и в Севастополе и п всему Крыму

becool: credent, Да я ничего не имею ввиду, просто суть того что я сказал что уровенькультуры в современной российской и украинской пропаганде меньше чем был в ссср

Allexx: Друзья в Мукачево - это гут.

credent: мне повигу пропаганда, общаюсь с первоисточниками

evsd: becool, пропаганду не трож

becool: credent, у да, правильно, а у современной молодежи нет друзей, только название осталось, а так приятели прихлебатели, собраться бухнуть шашлычк ипотрахаться

evsd: becool, как обьяснить дибилу, что он патриот

becool: credent, Даже тут в этом чате тебе скажут что Питер это понты мол, культура нахрен она нужна, едь в Москву

becool: credent, Хотя это как бы не самые тупые тут собрались

becool: credent, В Москве мол деньги в Москве всё, а старые здания смотреть крундовые понты мол

Allexx: в этом чате некоторые говорят, что главное - это расстояние до метро. Мой пердак от этого полыхает огнищщщем

credent: becool, панты.. смешно, этож в детстве

becool: Allexx, А ты в реале не пробовал торговать?

becool: Allexx, из-за 100 рублей заработка придется туда и обратно к метро пердохать, в другой раз и 500 и 1000

Allexx: becool, ток гербалайфом

becool: Allexx, Не очень то люди склонны с метро выйти и еще ехать куда-то чтобы у тебя что-то купить

evsd: я был челноком

evsd: ничего плохого не вижу

becool: Allexx, а держаьт своего человека им рядом с метро напряжно будет

becool: То есть крайне затратно и/или потом эотт человек левака и будет пускать вместо тебя

becool: Вмест тебя продавать

becool: А в день бывало и по 5 раз на дню к метро ходить нужно было!

LTC012: после установки двухфакторной аутентификации холд ставят на вывод денежных средств? сейчас хотел выписать btc-e код. пишет ошибку Money hold. 42 hours left

becool: Вроде каждый раз п 500-1000 рублей навару, но ведь блин а как сократить то расходы на пердячий пар? вот тут то и оно

Tuesha12: а правда что психам не надо 1К на чат, а достаточно фото справки из дурки прислать?

evsd: когда кто то на гитарах брынькал, кто то дефицит немного делал не заметным

bgt: ))

becool: Если ты дальше 5-10 минут неспешным шагом от метро то нито не пойдет а ехать тоже не поедет, в итоге если ббудешь говориь едьте - потеря как минимум половины клиентов

becool: Tuesha12, Правда

becool: Tuesha12, Поэтому в других чатах этот чат зовут "нарки"))

Allexx: becool, с гербалайфом это всё не страшно. Надел костюм ч0рный как будто инопланетян разгоняешь, взял портфель и пошёл окучивать дам.

becool: Allexx, Алекс, ну так и думай мне важно бы поближе к метро и побольше площади или нет? Один товар продал считай уже день работы у дяди!

becool: Allexx, А у меня асортимент! Я не гербалайф, я только продаю что сам жру, а гербалайф я не жру!

becool: Понимаю что для барыги это не правильно, но я не барыга, я честный спекуль, что сам жру то и другим даю

alpet: интересно, какая завтра движуха будет если ФРС вдруг откажется ставку поднимать

KonradSvonson: Барыгу как не назови останется барыгой :) ничего личного дядь

becool: Allexx, Вот думаю раз никак купить рядом с метро земли для ангара склада то может гараж попробовать купить..

Allexx: ангар-склад рядом с метро - это дорогого стоит, да-а...

becool: Allexx, И самый ходовой товар туда, но эот не отменчет того что самому переть, просто может потом появится кто работник

becool: Allexx, Ну вот потому я и поставил сарай в паре-трех километрах от метро, свой срай на своей земле, пошли все нахер

Allexx: becool, а ты шестиклассников летом на подработку принимаешь?

alpet: Сбербанк вышел в высокую перепроданность, думаю завтра шортить его на отскок )

becool: Allexx, У меня тут естесно не только свиньи, тутеще и стелажи с электроникой

becool: Allexx, Не, я не хочу с этого чата никого видеть.

Allexx: becool, у меня есть добрый брат-близнец

becool: Allexx, Посто смотри почему я животноводство там и производство пытаюсь и прочее такое

Allexx: ты чем свиней-то кормишь?

becool: Allexx, Потому что тогда можно уже людей заманивать и далеко, например те же животные в питере редкость, обычновсе впригород едут, а тут опа

becool: Allexx, Кроме того хотя бы теоретически можно оптом продавать

becool: Allexx, А так купи продай только розница, для опта нужно арендовать склады и х.з. можно эот делать без регистрации бизнеса или нет

becool: А так сидишь в своем ангаре хочешь машины ремонтишь хочешь чего твоей душе вздумается

becool: С чего есть навар то и делаешь

Allexx: А то мне классная грозится, что на шестой год меня не оставит, думаю вот теперь, то ли герычем торговать идти, то ли хер его знает.

becool: ы раньше умным был

Allexx: так вишь, скатился. Шалавы-старшеклассницы, водка, беломор.

becool: Капец

Allexx: ога.

evsd: Allexx, анну каренину прочитай и пойми смысл

evsd: тогда под поезд как сейчас под ракету

Allexx: evsd, анну каренину только в десятом классе проходят. Я при нынешних успехах до десятого класса годам к семидесяти доберусь.

Allexx: Печень только к тому времени давно откажет.

evsd: достоевский всем нравится мне нет

evsd: Allexx, по моему ты дошел до 9 джана по хитрости

becool: ты не понял достоевского

Allexx: джан - это мальчик по-узбекски. Разряд в спорте - дан.

evsd: becool, и не собираюсь

becool: а я вот как понял уже тогда сразу стал психом

Allexx: А до мальчиков я ещё не дошёл чтобы доходить

evsd: Allexx, что ты хочешь?

becool: Современная культура говорит что человек виноват в содеяном. но на самом деле она его толкает на преступление

Allexx: evsd, спать

evsd: Allexx, так спи и не еб мозги в культурном обществе

Allexx: гы-гы. (ушёл, затихнув гыгыканьем вдали)

becool: Если ты живешь в гармонии с природой и обществом чем ты отличаешься от цветочка или животного, почемуты должен отвечать за свои поступки?

evsd: а что Достоевский, что Толстой, это нынешний сериал

evsd: ковыряться в чужом, не интерестно

becool: Не совсем, мысли то совсем другие относительно других писателей, но схжесть в чем-тоесть

becool: сериалы хуже, они думать совсем не заставляют

Allexx: becool, ворониных только вот с чёрным зеркалом не сравнивай.

Allexx: например

Allexx: я просто на минутку заглянул

becool: черное зеркало такое же говно

Allexx: нет. Оно шевелит мозги и рефлексию. Рефлексию сильнее.

evsd: Помоему все это глупость,

becool: единственная разница что творчествапо самой идеи на 3 минуты добавлено в черном зеркале, а в ворониных разбрызгано не в идее а в диалогах, а в целом тупость

evsd: Есть немного истории, хорошщо, но немного остальное все чепуха

becool: А вот мистер робот и правда получше

evsd: И я не могу заставиь ребенка это учить

becool: историю?

evsd: , потомучто бред, извините

becool: Потому что в школе ее не так учат

becool: А ты почитай биографии людей, интересно

evsd: becool, биографию интерестно

becool: Это самое интересное вистории, а другое интересно докопатьсяв моментах

becool: Ну так вот именно

Allexx: becool, потому что история без собственного жизненного опыта и опыта переоценки случившихся на личной памяти событий -- пуста и неинтересна.

becool: Просто разницамежду обычной историей точот в школе и той историей что как наука очень очень сильно

evsd: becool, я незнаю не одного стиха

becool: В школе тебя даты заставляют учить и названиятипачот такое монополия , как звали каких королей. естесно оно нравитсяможет олько ииотам такиесухие осатки

Allexx: То есть детям история - наука ни о чём, я так вижу. Он лет после тридцати как-то начинает по-другому восприниматься.

evsd: becool, зато умножу 265на562

becool: Allexx, что-то ты не как 6клсник чешешь тут нам

Allexx: becool, так я пятый год только в шестом классе сижу.

becool: Allexx, ты частично правильно сказал, но утт одно но! Именно потому что ты мало истории учил!

evsd: becool, неи может человек в 6 классе тут быть

Allexx: becool, может быть. Я правда её в школе не переносил. Вообще. На дух.

evsd: троль и пиздобол да

becool: Allexx, если бы ты читал биографии то у тебя жизненного опыта было бы больше уже в 20, пусть даже теоретического, а тысчитаешь все полководцы только по практике полководили?

becool: evsd, тут и пятилетние есть

Allexx: evsd, я никого не троллю ничем, а пиздобольствовать вроде не грех.

evsd: becool, как жизнь на марсе

Allexx: вот некоторые в субботу тут нажрамшись пиздоболили пол-вечера, разве им кто чего плохого сказал?

Allexx: becool, полководству тоже талант нужен. Слова "генералы всегда готовятся к прошедшим войнам" не на пустом месте возникли.

alpet: китайцы видимо опять будут подливать в ночную сессию биток

Aleksandrovich: они не идут в низ,стенку разбирают и стоят

evsd: о чнем мы, вопрос когда купленнное за 500 за 700 продатьмя или 1200

Aleksandrovich: роскосые че то задумали

becool: alpet, Эт что, тут тайна повара раскрыта

becool: alpet, с его кефиром

becool: Но наверно сегодня не стоит освечащть тайны поздно уже все спят?

Aleksandrovich: давай уже

becool: завтра сами всё увидите

Aleksandrovich: becool, экран с утра переворачивать?

becool: Aleksandrovich,ссылка наразоблачение повара будет!

becool: Aleksandrovich, С чего всё это начиналось как готовилось и в какой роли повар

Aleksandrovich: becool, в платье?)

becool: Aleksandrovich, Нет, такого нет

becool: А он и тебе продал кефира?

Aleksandrovich: он всем продовал)

becool: Вся правда о кефире и разоблачение повара будет завтра

Aleksandrovich: у меня былдо

becool: Aleksandrovich, Ну всё тогда. значит тебе тоже интереснобудет смотреть

Aleksandrovich: becool, да я и без этого поглазею

Aleksandrovich: ща сразу кефир приунынет(

alpet: доллару завтра не помешало-бы на 62 отскочить

jhsdf37: врядли, пока вниз

becool: Шортим кефир, завтра будет жара

jhsdf37: даже жалею что продал дерево

becool: Вот я честный парень сказал шортим сам пошел и зашортил

becool: Черт до завтра не дождаться козыри выложить

alpet: jhsdf37, на опасениях по ставке могут сыграть вверх.

jhsdf37: все уже ждут повышения - считай отыграно

becool: а, вы все правы

bitsotik: alpet, может быть и не помешало бы. А у тебя там баксы зависли или что? )